UniGene Name: sp_v3.0_unigene160797
Length: 225 nt
UniGene Fasta |
---|
>sp_v3.0_unigene160797
A |
Ace file of the UniGene sp_v3.0_unigene160797 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Mannan endo-1,4-beta-mannosidase 1 n=3 Tax=Oryza sativa RepID=MAN1_ORYSJ | - | - | 9.0e-26 | 68% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 41% |
Sma3 | 1,4-beta-D-mannan endohydrolase | - | - | 1.431e-08 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Mannan endo-1,4-beta-mannosidase. | EC:3.2.1.78 | - | 5.932e-26 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Fructose and mannose metabolism | 00051 | 5.932e-26 | % |
Source | Gene names |
---|---|
Sma3 | At3g10890; At5g66460; GSVIVT00014580001; GSVIVT00024894001; GSVIVT00032044001; GSVIVT00032045001; K1F13.12; LOC_Os01g47400; MA4_25J11.12; MAN1; MAN2; MAN3; MAN4; MAN5; MAN7; Man1; Os01g0663300; OsI_03157; OsJ_02911; P0671D01.40; POPTRDRAFT_1072489; POPTRD |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
Sma3 | hydrolase activity, hydrolyzing O-glycosyl compounds | GO:0004553 | Molecular Function | 0.0 | - |
Sma3 | hydrolase activity | GO:0016787 | Molecular Function | 0.0 | - |
Sma3 | mannan endo-1,4-beta-mannosidase activity | GO:0016985 | Molecular Function | 0.0 | - |
Sma3 | cation binding | GO:0043169 | Molecular Function | 0.0 | - |
Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Serine-threonine/tyrosine-protein kinase catalytic domain | IPR001245 | - | 0.0 | - |
Sma3 | Bulb-type lectin domain | IPR001480 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, family 5 | IPR001547 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, subgroup, catalytic domain | IPR013781 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, family 5, conserved site | IPR018087 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G66460.1 | MAN7, AtMAN7 Glycosyl hydrolase superfamily protein chr5:26538911-26540837 REVERSE LENGTH=431 | 3.0e-30 | 64% |
RefSeq | Arabidopsis thaliana | NP_201447.1 | mannan endo-1,4-beta-mannosidase 7 [Arabidopsis thaliana] | 3.0e-30 | 64% |
RefSeq | Populus trichocarpa | XP_002310816.1 | predicted protein [Populus trichocarpa] | 6.0e-33 | 67% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5A9Z9
Fln msg: Distance to subject end: 81 aas, your sequence is shorter than subject: 74 - 429
Fln protein:
F
Protein Length:
75
Fln nts:
A
Fln Alignment:
HA8LWWM01CNE92___FIANNRIPGIDFATVHSYPDTWLAGSDENAQLSFLNQWMQIHLEDAARVLKKPLLFAEFGKSYKDPGYSTAQRD
D5A9Z9________________FIWNSQVEEIDFASVHAYPDSWIPNVDLEDHLNYFSKWVTSHIDDGEQILKKPVLFTEFGLSSHHKGFEQSHRD
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain