UniGene Name: sp_v3.0_unigene160671
Length: 150 nt
UniGene Fasta |
---|
>sp_v3.0_unigene160671
G |
Ace file of the UniGene sp_v3.0_unigene160671 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | FAR1; Polynucleotidyl transferase, Ribonuclease H fold n=1 Tax=Medicago truncatula RepID=Q2HRZ3_MEDTR | - | - | 1.0e-11 | 72% |
FL-Next | tr=Putative uncharacterized protein; Vitis vinifera (Grape). | - | - | 0.0 | 76% |
Source | Gene names |
---|---|
Sma3 | MtrDRAFT_AC157777g26v2; VITISV_003711; VITISV_011880; VITISV_012031; VITISV_012977; VITISV_013041; VITISV_013478; VITISV_014148; VITISV_018166; VITISV_020159; VITISV_026680; VITISV_032573; VITISV_035856; VITISV_037062; VITISV_039388; VITISV_039497; VITISV |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | transporter activity | GO:0005215 | Molecular Function | 0.0 | - |
Sma3 | transferase activity | GO:0016740 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
Sma3 | Chromo domain/shadow | IPR000953 | - | 0.0 | - |
Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
Sma3 | Peptidase aspartic, active site | IPR001969 | - | 0.0 | - |
Sma3 | FAR1 DNA binding domain | IPR004330 | - | 0.0 | - |
Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
Sma3 | General substrate transporter | IPR005828 | - | 0.0 | - |
Sma3 | Peptidase aspartic, catalytic | IPR009007 | - | 0.0 | - |
Sma3 | Retroviral aspartyl protease | IPR013242 | - | 0.0 | - |
Sma3 | Zinc finger, H2C2-type, histone UAS binding | IPR015416 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | MULE transposase domain | IPR018289 | - | 0.0 | - |
Full-Lengther Next Prediction |
---|
Fln status: C-terminus
Fln database: tr_plants
Fln subject: A5AUA9
Fln msg: your sequence is shorter than subject: 45 - 106
Fln protein:
R
Protein Length:
46
Fln nts:
G
Fln Alignment:
HA8LWWM01A19HT___QEDIPKTTFRTHEVHYEFFVMPFGVTNAPSTFRTLMDSIFKP
A5AUA9________________ESDVHKTTFRTHEGHYEFLVMPFGLTNAPSTFQSLMDEIFKP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain