UniGene Name: sp_v3.0_unigene160662
Length: 122 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene160662
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | R2R3-Myb4 transcription factor (Fragment) n=1 Tax=Pinus pinaster RepID=B1PPT6_PINPS | - | - | 3.0e-12 | 87% |
FL-Next | tr=R2R3-MYB transcription factor MYB4; Picea glauca (White spruce) (Pinus glauca). | - | - | 0.0 | 87% |
Sma3 | MYB transcription factor | - | - | 7.625e-18 | - |
Source | Gene names |
---|---|
Sma3 | At1g09540; At1g22640; At1g34670; At1g57557; At1g57560; At1g63910; At1g74650; At3g08500; At3g12720; At3g12820; At3g13890; At4g01680; At4g01680/T15B16.4; At4g34990; At5g12870; At5g26660; B1215B07.15; F12K8.1; F14J9.20; F21E10.4; F21H2.9; F25P12.1; GSVIVT000 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | specific transcriptional repressor activity | GO:0016566 | Molecular Function | 0.0 | - |
Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
Sma3 | response to stress | GO:0006950 | Biological Process | 0.0 | - |
Sma3 | response to UV | GO:0009411 | Biological Process | 0.0 | - |
Sma3 | response to wounding | GO:0009611 | Biological Process | 0.0 | - |
Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
Sma3 | phenylpropanoid biosynthetic process | GO:0009699 | Biological Process | 0.0 | - |
Sma3 | response to ethylene stimulus | GO:0009723 | Biological Process | 0.0 | - |
Sma3 | response to auxin stimulus | GO:0009733 | Biological Process | 0.0 | - |
Sma3 | response to abscisic acid stimulus | GO:0009737 | Biological Process | 0.0 | - |
Sma3 | response to gibberellin stimulus | GO:0009739 | Biological Process | 0.0 | - |
Sma3 | response to salicylic acid stimulus | GO:0009751 | Biological Process | 0.0 | - |
Sma3 | response to jasmonic acid stimulus | GO:0009753 | Biological Process | 0.0 | - |
Sma3 | cinnamic acid biosynthetic process | GO:0009800 | Biological Process | 0.0 | - |
Sma3 | secondary cell wall biogenesis | GO:0009834 | Biological Process | 0.0 | - |
Sma3 | negative regulation of metabolic process | GO:0009892 | Biological Process | 0.0 | - |
Sma3 | GO:0045449 | Biological Process | 0.0 | - | |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Inositol monophosphatase | IPR000760 | - | 0.0 | - |
Sma3 | SANT/Myb domain | IPR001005 | - | 0.0 | - |
Sma3 | IPR012287 | - | 0.0 | - | |
Sma3 | IPR014778 | - | 0.0 | - | |
Sma3 | Myb transcription factor | IPR015495 | - | 0.0 | - |
Sma3 | Myb-like domain | IPR017877 | - | 0.0 | - |
Sma3 | Myb domain, DNA-binding | IPR017930 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G12820.1 | AtMYB10, MYB10 myb domain protein 10 chr3:4074328-4075614 REVERSE LENGTH=239 | 2.0e-16 | 83% |
RefSeq | Arabidopsis thaliana | NP_187888.1 | myb domain protein 10 [Arabidopsis thaliana] | 2.0e-16 | 83% |
RefSeq | Populus trichocarpa | XP_002313334.1 | predicted protein, partial [Populus trichocarpa] | 9.0e-18 | 79% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A5JYE8
Fln msg: Distance to subject end: 243 aas, your sequence is shorter than subject: 40 - 334
Fln protein:
L
Protein Length:
41
Fln nts:
T
Fln Alignment:
HA8LWWM01D6NCN___LQRCGKSCRLRWINYLRPGLKRGGFSREEEQLIIHLQSI
A5JYE8________________LQRCGKSCRLRWINYLRPDLKRGAFSPQEEQLIIHLHSI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain