UniGene Name: sp_v3.0_unigene160315
Length: 214 nt
UniGene Fasta |
---|
>sp_v3.0_unigene160315
C |
Ace file of the UniGene sp_v3.0_unigene160315 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Acetolactate synthase n=2 Tax=Galium aparine RepID=D3K640_GALAP | - | - | 5.0e-13 | 89% |
FL-Next | sp=Acetolactate synthase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 86% |
Sma3 | Acetolactate synthase | - | - | 0.0 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Acetolactate synthase. | EC:2.2.1.6 | - | 0.0 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Valine, leucine and isoleucine biosynthesis | 00290 | 0.0 | % | |
Sma3 | Butanoate metabolism | 00650 | 0.0 | % | |
Sma3 | C5-Branched dibasic acid metabolism | 00660 | 0.0 | % | |
Sma3 | Pantothenate and CoA biosynthesis | 00770 | 0.0 | % | |
Sma3 | Biosynthesis of alkaloids derived from histidine and purine | 01065 | 0.0 | % | |
Sma3 | Metabolic pathways | 01100 | 0.0 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 0.0 | % |
Source | Gene names |
---|---|
Sma3 | AHAS; AHAS1; AHAS109; AHAS2; AHAS3; ALS; ALS SURA; ALS SURB; ALS1; ALS2; ALSL1; At3g48560; CHLREDRAFT_138180; CSR 1.2; CSR1; GSVIVT00037861001; LOC_Os02g30630; LOC_Os04g32010; MICPUCDRAFT_36361; MICPUN_88562; MtrDRAFT_AC157507g23v2; OSIGBa0096P03.6; OSJNB |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
Sma3 | acetolactate synthase activity | GO:0003984 | Molecular Function | 0.0 | - |
Sma3 | transferase activity | GO:0016740 | Molecular Function | 0.0 | - |
Sma3 | lyase activity | GO:0016829 | Molecular Function | 0.0 | - |
Sma3 | thiamine pyrophosphate binding | GO:0030976 | Molecular Function | 0.0 | - |
Sma3 | flavin adenine dinucleotide binding | GO:0050660 | Molecular Function | 0.0 | - |
Sma3 | branched chain family amino acid biosynthetic process | GO:0009082 | Biological Process | 0.0 | - |
Sma3 | response to herbicide | GO:0009635 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | TPP-binding enzyme, conserved site | IPR000399 | - | 0.0 | - |
Sma3 | Thiamine pyrophosphate enzyme, C-terminal TPP-binding | IPR011766 | - | 0.0 | - |
Sma3 | Thiamine pyrophosphate enzyme, central domain | IPR012000 | - | 0.0 | - |
Sma3 | Thiamine pyrophosphate enzyme, N-terminal TPP-binding domain | IPR012001 | - | 0.0 | - |
Sma3 | Acetolactate synthase, large subunit, biosynthetic | IPR012846 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G48560.1 | CSR1, ALS, AHAS, TZP5, IMR1 chlorsulfuron/imidazolinone resistant 1 chr3:18001530-18003542 REVERSE LENGTH=670 | 6.0e-15 | 83% |
RefSeq | Arabidopsis thaliana | NP_190425.1 | acetolactate synthase [Arabidopsis thaliana] | 8.0e-15 | 83% |
RefSeq | Populus trichocarpa | XP_002318731.1 | predicted protein [Populus trichocarpa] | 7.0e-17 | 91% |
Full-Lengther Next Prediction |
---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: B8LK99
Fln msg: your sequence is shorter than subject: 47 - 669
Fln protein:
H
Protein Length:
48
Fln nts:
C
Fln Alignment:
HA8LWWM01C1OV7___PEPYLLDAIVPHQEHVLPMIPSGGAFKDIITEGDGR
B8LK99________________PGPYLLDVIVPHQEHVLPMIPAGGSFKEIITEGDGR
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain