SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene160206

Length: 409 nt

UniGene Fasta

>sp_v3.0_unigene160206
AGGTCCTCAAAGCTTTTGGGAACAAGAGAGGATTGCTCAGTGGGCTCAATTTGCGGAACACGGTTACCGGTGAGGAGTCGGCGTTGGAAGTGTCGGGGTTGTTCTTTGCAATCGGGCATGAACCAGCCACCAAGTTTCTGGAGGGGCAACTGGAGTTGGACTCGGACGGTTACATTGTGACAAAGCCTGGAACCACCCAGACGAGTCTTCCGGGGGTTTTCGCCGCCGGAGATGTTCAGGACAAGAAATGGCGCCAAGCCATCACTGCTGCCGGTACAGGGTGTATGGCAGCACTGGAAGCTGAGCACTTCTTACAAGAGATAGCGGTACAGGAGGAGGATACTGAGCGAGATAGCGGCACAGGAGGGTCCTGAGAGTTCCCGGCCTGTCTGAGGATGTCAGAGCAGCG

Ace file of the UniGene sp_v3.0_unigene160206

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	Identity
AutoFact	Thioredoxin reductase n=2 Tax=Picea sitchensis RepID=A9NXV4_PICSI	-	-	88%
FL-Next	sp=Thioredoxin reductase; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	90%
Sma3	Thioredoxin reductase	-	-	-

Source	ECs	Term	Type	e value	Identity
Sma3	Thioredoxin-disulfide reductase.	EC:1.8.1.9	-	0.0	-

Source	KEGGs	Term	Type	e value	Identity
Sma3	Pyrimidine metabolism	00240		0.0	%
Sma3	Selenocompound metabolism	00450		0.0	%

Source	Gene names
Sma3	At2g17420; At2g41680; At2g41680/T32G6.20; At4g35460; CHLREDRAFT_132865; CHLREDRAFT_196120; CHLREDRAFT_78928; CvNTR-C; F5J6.18; GSVIVT00006001001; GSVIVT00025615001; MICPUCDRAFT_23559; NTR1; NTR2; NTR3; NTRC; NTRC1; OJ1479_B12.9; OSJNBb0039F24.13; OSTLU_28

Source	GOs	Term	Type	Identity
Sma3	cytoplasm	GO:0005737	Cellular Component	-
Sma3	mitochondrion	GO:0005739	Cellular Component	-
Sma3	mitochondrial matrix	GO:0005759	Cellular Component	-
Sma3	cytosol	GO:0005829	Cellular Component	-
Sma3	chloroplast stroma	GO:0009570	Cellular Component	-
Sma3	chloroplast envelope	GO:0009941	Cellular Component	-
Sma3	thioredoxin-disulfide reductase activity	GO:0004791	Molecular Function	-
Sma3	electron carrier activity	GO:0009055	Molecular Function	-
Sma3	oxidoreductase activity	GO:0016491	Molecular Function	-
Sma3	flavin adenine dinucleotide binding	GO:0050660	Molecular Function	-
Sma3	pollen germination	GO:0009846	Biological Process	-
Sma3	cell growth	GO:0016049	Biological Process	-
Sma3	removal of superoxide radicals	GO:0019430	Biological Process	-
Sma3	hydrogen peroxide catabolic process	GO:0042744	Biological Process	-
Sma3	thioredoxin biosynthetic process	GO:0042964	Biological Process	-
Sma3	cell redox homeostasis	GO:0045454	Biological Process	-
Sma3	response to cadmium ion	GO:0046686	Biological Process	-
Sma3	seed development	GO:0048316	Biological Process	-
Sma3	oxidation-reduction process	GO:0055114	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Pyridine nucleotide-disulphide oxidoreductase, class-II	IPR000103	-	-
Sma3	Pyridine nucleotide-disulphide oxidoreductase, NAD-binding domain	IPR001327	-	-
Sma3	Thioredoxin reductase	IPR005982	-	-
Sma3	Pyridine nucleotide-disulphide oxidoreductase, class-II, active site	IPR008255	-	-
Sma3		IPR012335	-	-
Sma3	FAD-dependent pyridine nucleotide-disulphide oxidoreductase	IPR013027	-	-
Sma3	Thioredoxin domain	IPR013766	-	-
Sma3		IPR015467	-	-
Sma3	NAD(P)-binding domain	IPR016040	-	-
Sma3		IPR017909	-	-
Sma3		IPR017936	-	-
Sma3	Thioredoxin, conserved site	IPR017937	-	-

Source	Species	ID	Description	Identity
ATG	Arabidoptis thaliana	AT4G35460.1	ATNTRB, NTRB, NTR1 NADPH-dependent thioredoxin reductase B chr4:16842218-16843740 FORWARD LENGTH=375	75%
RefSeq	Arabidopsis thaliana	NP_195271.2	thioredoxin reductase 1 [Arabidopsis thaliana]	75%
RefSeq	Populus trichocarpa	XP_002298998.1	predicted protein, partial [Populus trichocarpa]	72%

Full-Lengther Next Prediction

Fln status: C-terminus

Fln database: coniferopsida.fasta

Fln subject: A9NU83

Fln msg: your sequence is shorter than subject: 124 - 340

Fln protein: VLKAFGNKRGLLSGLNLRNTVTGEESALEVSGLFFAIGHEPATKFLEGQLELDSDGYIVTKPGTTQTSLPGVFAAGDVQDKKWRQAITAAGTGCMAALEAEHFLQEIAVQEEDTERDSGTGGS*

Protein Length: 125

Fln nts: AGGTCCTCAAAGCTTTTGGGAACAAGAGAGGATTGCTCAGTGGGCTCAATTTGCGGAACACGGTTACCGGTGAGGAGTCGGCGTTGGAAGTGTCGGGGTTGTTCTTTGCAATCGGGCATGAACCAGCCACCAAGTTTCTGGAGGGGCAACTGGAGTTGGACTCGGACGGTTACATTGTGACAAAGCCTGGAACCACCCAGACGAGTCTTCCGGGGGTTTTCGCCGCCGGAGATGTTCAGGACAAGAAATGGCGCCAAGCCATCACTGCTGCCGGTACAGGGTGTATGGCAGCACTGGAAGCTGAGCACTTCTTACAAGAGATAGCGGTACAGGAGGAGGATACTGAGCGAGATAGCGGCACAGGAGGGTCCTGA___GAGTTCCCGGCCTGTCTGAGGATGTCAGAGCAGCG

Fln Alignment:

HA8LWWM01ESXG6___VLKAFGNKRGLLSGLNLRNTVTGEESALEVSGLFFAIGHEPATKFLEGQLELDSDGYIVTKPGTTQTSLPGVFAAGDVQDKKWRQAITAAGTGCMAALEAEHFLQEIAVQE
A9NU83________________VLKASGNERGLLSGLDLRNTVTGEASVLEVFGLFFAIGHEPATKFLEGQLELDTDGYIVTKPGTTQTSIPGVFAAGDVQDKKWRQAITAAGTGCMAALEAEHFLQEIGAQE

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain