UniGene Name: sp_v3.0_unigene160153
Length: 240 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene160153
T |
Ace file of the UniGene sp_v3.0_unigene160153 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Putative ubiquitin-conjugating enzyme E2 n=1 Tax=Dictyostelium fasciculatum RepID=F4Q3I2_9MYCE | - | - | 2.0e-27 | 86% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 78% |
| Sma3 | Ubiquitin carrier protein | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ligases, Forming carbon-nitrogen bonds, Acid--D-amino-acid ligases (peptide synthases). | EC:6.3.2.- | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Tryptophan metabolism | 00380 | 0.0 | % | |
| Sma3 | Biosynthesis of siderophore group nonribosomal peptides | 01053 | 0.0 | % | |
| Sma3 | Ubiquitin--protein ligase. | EC:6.3.2.19 | - | 4.758e-11 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g16890; At1g64230; At1g78870; At2g16740; At3g08690; At4g27960; At5g41700; At5g50870; At5g53300; B0811B10.8; B1043F11.37; CHLREDRAFT_129070; CHLREDRAFT_152525; F17F16.19; F17O14.16; F22C12.2; F6I1.11; F9K20.8; GSVIVT00002469001; GSVIVT00006484001; GSVIV |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | UBC13-MMS2 complex | GO:0031372 | Cellular Component | 0.0 | - |
| Sma3 | ubiquitin-protein ligase activity | GO:0004842 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | small conjugating protein ligase activity | GO:0019787 | Molecular Function | 0.0 | - |
| Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
| Sma3 | modification-dependent protein catabolic process | GO:0019941 | Biological Process | 0.0 | - |
| Sma3 | post-translational protein modification | GO:0043687 | Biological Process | 0.0 | - |
| Sma3 | cell redox homeostasis | GO:0045454 | Biological Process | 0.0 | - |
| Sma3 | regulation of protein metabolic process | GO:0051246 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ubiquitin-associated/translation elongation factor EF1B, N-terminal | IPR000449 | - | 0.0 | - |
| Sma3 | Ubiquitin-conjugating enzyme, E2 | IPR000608 | - | 0.0 | - |
| Sma3 | Haloacid dehalogenase-like hydrolase | IPR005834 | - | 0.0 | - |
| Sma3 | HAD-superfamily hydrolase, subfamily IA, variant 3 | IPR006402 | - | 0.0 | - |
| Sma3 | Thioredoxin domain | IPR013766 | - | 0.0 | - |
| Sma3 | Ubiquitin-associated/translation elongation factor EF1B, N-terminal, eukaryote | IPR015940 | - | 0.0 | - |
| Sma3 | Ubiquitin-conjugating enzyme/RWD-like | IPR016135 | - | 0.0 | - |
| Sma3 | IPR017936 | - | 0.0 | - | |
| Sma3 | Thioredoxin, conserved site | IPR017937 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G16890.3 | - | 3.0e-33 | 78% |
| RefSeq | Arabidopsis thaliana | NP_849678.1 | ubiquitin-conjugating enzyme E2 36 [Arabidopsis thaliana] | 1.0e-33 | 78% |
| RefSeq | Populus trichocarpa | XP_002316867.1 | predicted protein [Populus trichocarpa] | 4.0e-33 | 78% |
Full-Lengther Next Prediction |
|---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NUN0
Fln msg: STOP codon was not found. Distance to subject end: 7 aas, your sequence is shorter than subject: 79 - 153
Fln protein:
N
Protein Length:
80
Fln nts:
T
Fln Alignment:
HA8LWWM01DVWY4___NIDRLGRICLDILKAQWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEHWKQNEQAAIATAREWT
A9NUN0________________NIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWT

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)