UniGene Name: sp_v3.0_unigene159841
Length: 220 nt
UniGene Fasta |
---|
>sp_v3.0_unigene159841
A |
Ace file of the UniGene sp_v3.0_unigene159841 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | putative cytochrome P450 [Lolium rigidum] | - | - | 5.0e-20 | 58% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 61% |
Sma3 | Cytochrome P450 | - | - | 2.249e-13 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Secologanin synthase. | EC:1.3.3.9 | - | 1.005e-17 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Monoterpenoid biosynthesis | 00902 | 1.005e-17 | % | |
Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 1.005e-17 | % | |
Sma3 | Biosynthesis of alkaloids derived from terpenoid and polyketide | 01066 | 1.005e-17 | % | |
Sma3 | Metabolic pathways | 01100 | 1.005e-17 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.005e-17 | % |
Source | Gene names |
---|---|
Sma3 | At1g67110; At2g46950; At3g14620; At5g24910; At5g38450; CL-8904; CYP709C1; CYP714E5v2; CYP72; CYP72A1; CYP72A18; CYP72A21; CYP72A42v3; CYP72A43; CYP72A44; CYP72A45Pv1; CYP72A47; CYP72A59; CYP72A65; CYP72A84; CYP72B; CYP72C; CYP72D1; CYP72D2-1; CYP735A5; CY |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | vacuolar membrane | GO:0005774 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | monooxygenase activity | GO:0004497 | Molecular Function | 0.0 | - |
Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
Sma3 | secologanin synthase activity | GO:0050616 | Molecular Function | 0.0 | - |
Sma3 | alkaloid metabolic process | GO:0009820 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Peptidase, cysteine peptidase active site | IPR000169 | - | 0.0 | - |
Sma3 | Cytochrome P450 | IPR001128 | - | 0.0 | - |
Sma3 | Cytochrome P450, E-class, group I | IPR002401 | - | 0.0 | - |
Sma3 | Cytochrome P450, E-class, group II | IPR002402 | - | 0.0 | - |
Sma3 | Cytochrome P450, E-class, group IV | IPR002403 | - | 0.0 | - |
Sma3 | O-acyltransferase, WSD1, C-terminal | IPR009721 | - | 0.0 | - |
Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
Sma3 | IPR017973 | - | 0.0 | - | |
Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
Sma3 | Hemopexin/matrixin, conserved site | IPR018486 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G24910.1 | CYP714A1 cytochrome P450, family 714, subfamily A, polypeptide 1 chr5:8567674-8570260 REVERSE LENGTH=532 | 1.0e-24 | 54% |
RefSeq | Arabidopsis thaliana | NP_568463.1 | cytochrome P450, family 714, subfamily A, polypeptide 1 [Arabidopsis thaliana] | 2.0e-24 | 54% |
RefSeq | Populus trichocarpa | XP_002332521.1 | cytochrome P450 [Populus trichocarpa] | 2.0e-27 | 60% |
Full-Lengther Next Prediction |
---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NWW9
Fln msg: STOP codon was not found. Distance to subject end: 9 aas, your sequence is shorter than subject: 73 - 517
Fln protein:
F
Protein Length:
74
Fln nts:
A
Fln Alignment:
HA8LWWM01AWCY0___FNPQRFAEGVQKACKHQMGFLPFSSGPRVCLGQSFAIMEAKVVLAMILSCFKFTLSPNYRHAPVCVLTLKPKH
A9NWW9________________FNPARFSEGIAKAVKHPLAFMPFGFGPRICVGQNFALLEAKVVLAMILQRFSFVTSPSYAHAPVMVVTVRPQH
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain