|
||||||
|
UniGene Name: sp_v3.0_unigene159732
Length: 224 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene159732
C |
|
Ace file of the UniGene sp_v3.0_unigene159732
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | DUF659 domain containing protein | - | - | 8.0e-29 | 72% |
| FL-Next | tr=Putative uncharacterized protein; Vitis vinifera (Grape). | - | - | 0.0 | 63% |
| Source | Gene names |
|---|---|
| Sma3 | At5g31412; GSVIVT00000858001; GSVIVT00001531001; GSVIVT00001874001; GSVIVT00002235001; GSVIVT00002367001; GSVIVT00003156001; GSVIVT00005726001; GSVIVT00006112001; GSVIVT00012114001; GSVIVT00013610001; GSVIVT00014165001; GSVIVT00019252001; GSVIVT0002200300 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | ubiquitin thiolesterase activity | GO:0004221 | Molecular Function | 0.0 | - |
| Sma3 | hydrolase activity, hydrolyzing O-glycosyl compounds | GO:0004553 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | protein dimerization activity | GO:0046983 | Molecular Function | 0.0 | - |
| Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
| Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G17450.1 | hAT dimerisation domain-containing protein chr3:5972793-5975684 REVERSE LENGTH=877 | 1.0e-16 | 51% |
| RefSeq | Arabidopsis thaliana | NP_188371.1 | hAT dimerization domain-containing protein [Arabidopsis thaliana] | 2.0e-16 | 51% |
| RefSeq | Populus trichocarpa | XP_002329897.1 | predicted protein, partial [Populus trichocarpa] | 1.0e-18 | 58% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: tr_plants
Fln subject: F6I3V3
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 53 aas, your sequence is shorter than subject: 60 - 480
Fln protein:
N
Protein Length:
61
Fln nts:
C
Fln Alignment:
HA8LWWM01BUMK4___NVVQIITDNASNYVPAGKMLEEKHKTIFWTPCAAHCIDLMLEDIGKIDWVKNTVEHA
F6I3V3________________NVIQVITDNHSSYVMAGRLLELKRPHLYWTPCAAHCLDLMLEDIGKLPNIKRTLERA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
