|
||||||
|
UniGene Name: sp_v3.0_unigene159645
Length: 218 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene159645
A |
|
Ace file of the UniGene sp_v3.0_unigene159645
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | MSI type nucleosome/chromatin assembly factor C (ISS) n=1 Tax=Ostreococcus tauri RepID=Q00YD9_OSTTA | - | - | 2.0e-22 | 53% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 58% |
| Sma3 | WD-40 repeat-containing protein MSI1 | - | - | 6.427e-09 | - |
| Source | Gene names |
|---|---|
| Sma3 | At5g58230; B1394A07.14; CHLREDRAFT_131412; GSVIVT00030810001; LOC_Os03g43890; MCK7.10; MICPUCDRAFT_49651; MICPUN_86547; MSI1; NFC1501; NFC901; NFC902; OSTLU_26671; Os03g0640100; OsI_12765; OsI_32211; OsJ_11856; Ot12g00130; PHYPADRAFT_159414; POPTRDRAFT_81 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | chromatin remodeling complex | GO:0016585 | Cellular Component | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | DNA replication | GO:0006260 | Biological Process | 0.0 | - |
| Sma3 | regulation of gene expression by genetic imprinting | GO:0006349 | Biological Process | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | cell proliferation | GO:0008283 | Biological Process | 0.0 | - |
| Sma3 | pollen development | GO:0009555 | Biological Process | 0.0 | - |
| Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
| Sma3 | regulation of flower development | GO:0009909 | Biological Process | 0.0 | - |
| Sma3 | trichome differentiation | GO:0010026 | Biological Process | 0.0 | - |
| Sma3 | seed coat development | GO:0010214 | Biological Process | 0.0 | - |
| Sma3 | heterochromatin assembly | GO:0031507 | Biological Process | 0.0 | - |
| Sma3 | positive regulation of cell cycle | GO:0045787 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | WD40 repeat | IPR001680 | - | 0.0 | - |
| Sma3 | WD40/YVTN repeat-like-containing domain | IPR015943 | - | 0.0 | - |
| Sma3 | WD40-repeat-containing domain | IPR017986 | - | 0.0 | - |
| Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
| Sma3 | IPR019782 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G58230.1 | MSI1, MEE70, ATMSI1 Transducin/WD40 repeat-like superfamily protein chr5:23556112-23557994 FORWARD LENGTH=424 | 1.0e-28 | 54% |
| RefSeq | Arabidopsis thaliana | NP_200631.1 | histone-binding protein RBBP4 [Arabidopsis thaliana] | 2.0e-28 | 54% |
| RefSeq | Populus trichocarpa | XP_002320581.1 | nucleosome/chromatin assembly factor group [Populus trichocarpa] | 5.0e-28 | 52% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AAF8
Fln msg: Distance to subject end: 20 aas, your sequence is shorter than subject: 72 - 401
Fln protein:
S
Protein Length:
73
Fln nts:
A
Fln Alignment:
HA8LWWM01CCOO1___SADKTVKLFDLRKLSCSLHTFSNH--------------------------IIGD----EQTSEDAEDGPPELIFIHGGHTSKISDFSWNLHDDWLIASVAED
D5AAF8________________SMDKTVKLFDLRKLSCSLHTFSNHTEQVFQIEWSPTNETILASSGADRRLMVWDLARIGETPEDEEDGPPELLFVHGGHTSKISDFSWNLNDDWVIASVAED
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
