SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene159494

Length: 480 nt

UniGene Fasta

>sp_v3.0_unigene159494
TGGTTACTCTAATGCAGATTGGGCCGGCAGTGAGGTGGATCGCAAAAGCACATCAGGATGTTGCTTCTCTCTAGGTTTTGCTTCAATATCATGGATGAGCAAGAAGCAAAAGTTGGTTGCTTTAAGCATCGCTAAGGCTGAATACATTGTTGCTAGTTTGGCCTCTTGTGAAGCTGTCTGGTTGAGGAGGCTCTTTAGTGAGCTATTTGGACATGTGTTGGATACCACTGTGATCTTCTGCGACAACCAGAGTGGGATTTGTCTTTCTGAGAATCCCGTGTTTCGTGATCGATCCAAGGATATTGATATCAGGTACCACTTTATCCGGAATATGGTACAGCGAAGAGCAATAAGGCTCCATCATATTGGGACCAATGCCGATATTCTTACGAAGCCCCTCCGGAAGGTCAAATTCTTAACCTTCCGTGAACGACTTGGAGTCATGGAGAGACCCTCTTATGAGGATCCTCTATGAGAAGG

Ace file of the UniGene sp_v3.0_unigene159494

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Unassigned protein	-	-	0.0	-
FL-Next	tr=Reverse transcriptase; Picea glauca (White spruce) (Pinus glauca).	-	-	0.0	43%
Sma3	Retrotransposon protein, putative, Ty1-copia subclass	-	-	7.72e-14	-

Source	Gene names
Sma3	AT4g02960; AtRE2; AtRE2-1; B1110B01.4; F11I4_21; LOC_Os03g05850; LOC_Os03g47702; LOC_Os10g04074; LOC_Os10g07460; LOC_Os10g20660; LOC_Os10g29420; LOC_Os11g01090; LOC_Os11g06960; LOC_Os11g09330; LOC_Os11g35590; LOC_Os11g42720; LOC_Os11g43560; LOC_Os11g44190

Source	GOs	Term	Type	Identity
Sma3	nucleic acid binding	GO:0003676	Molecular Function	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	RNA binding	GO:0003723	Molecular Function	-
Sma3	catalytic activity	GO:0003824	Molecular Function	-
Sma3	RNA-directed DNA polymerase activity	GO:0003964	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	zinc ion binding	GO:0008270	Molecular Function	-
Sma3	oxidoreductase activity	GO:0016491	Molecular Function	-
Sma3	tRNA dihydrouridine synthase activity	GO:0017150	Molecular Function	-
Sma3	rRNA N-glycosylase activity	GO:0030598	Molecular Function	-
Sma3	flavin adenine dinucleotide binding	GO:0050660	Molecular Function	-
Sma3	RNA-dependent DNA replication	GO:0006278	Biological Process	-
Sma3	apoptotic process	GO:0006915	Biological Process	-
Sma3	tRNA processing	GO:0008033	Biological Process	-
Sma3	DNA integration	GO:0015074	Biological Process	-
Sma3	negative regulation of translation	GO:0017148	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Peptidase S8/S53, subtilisin/kexin/sedolisin	IPR000209	-	-
Sma3	BTB/POZ-like	IPR000210	-	-
Sma3	GPCR, rhodopsin-like, 7TM	IPR000276	-	-
Sma3	Reverse transcriptase	IPR000477	-	-
Sma3	tRNA-dihydrouridine synthase	IPR001269	-	-
Sma3	Tetratricopeptide TPR-1	IPR001440	-	-
Sma3	Integrase, catalytic core	IPR001584	-	-
Sma3	Zinc finger, CCHC-type	IPR001878	-	-
Sma3	Ankyrin repeat	IPR002110	-	-
Sma3	NB-ARC	IPR002182	-	-
Sma3	Short-chain dehydrogenase/reductase SDR	IPR002198	-	-
Sma3	Glucose/ribitol dehydrogenase	IPR002347	-	-
Sma3	Argonaute/Dicer protein, PAZ	IPR003100	-	-
Sma3	Stem cell self-renewal protein Piwi	IPR003165	-	-
Sma3	HhH-GPD domain	IPR003265	-	-
Sma3	Domain of unknown function DUF1336	IPR009769	-	-
Sma3	CCT domain	IPR010402	-	-
Sma3	BTB/POZ fold	IPR011333	-	-
Sma3	Tetratricopeptide-like helical	IPR011990	-	-
Sma3	Tetratricopeptide repeat-containing domain	IPR013026	-	-
Sma3	BTB/POZ	IPR013069	-	-
Sma3		IPR013084	-	-
Sma3	Reverse transcriptase, RNA-dependent DNA polymerase	IPR013103	-	-
Sma3	Aldolase-type TIM barrel	IPR013785	-	-
Sma3	Domain of unknown function DUF1785	IPR014811	-	-
Sma3	NAD(P)-binding domain	IPR016040	-	-
Sma3	Glycoside hydrolase, family 5, conserved site	IPR018087	-	-
Sma3	Superoxide dismutase, copper/zinc, binding site	IPR018152	-	-
Sma3	Carbohydrate kinase, FGGY, conserved site	IPR018483	-	-
Sma3	tRNA-dihydrouridine synthase, conserved site	IPR018517	-	-
Sma3	Tetratricopeptide repeat	IPR019734	-	-

Full-Lengther Next Prediction

Fln status: C-terminus

Fln database: coniferopsida.fasta

Fln subject: Q9M5J7

Fln msg: your sequence is shorter than subject: 158 - 542

Fln protein: GYSNADWAGSEVDRKSTSGCCFSLGFASISWMSKKQKLVALSIAKAEYIVASLASCEAVWLRRLFSELFGHVLDTTVIFCDNQSGICLSENPVFRDRSKDIDIRYHFIRNMVQRRAIRLHHIGTNADILTKPLRKVKFLTFRERLGVMERPSYEDPL*

Protein Length: 159

Fln nts: TGGTTACTCTAATGCAGATTGGGCCGGCAGTGAGGTGGATCGCAAAAGCACATCAGGATGTTGCTTCTCTCTAGGTTTTGCTTCAATATCATGGATGAGCAAGAAGCAAAAGTTGGTTGCTTTAAGCATCGCTAAGGCTGAATACATTGTTGCTAGTTTGGCCTCTTGTGAAGCTGTCTGGTTGAGGAGGCTCTTTAGTGAGCTATTTGGACATGTGTTGGATACCACTGTGATCTTCTGCGACAACCAGAGTGGGATTTGTCTTTCTGAGAATCCCGTGTTTCGTGATCGATCCAAGGATATTGATATCAGGTACCACTTTATCCGGAATATGGTACAGCGAAGAGCAATAAGGCTCCATCATATTGGGACCAATGCCGATATTCTTACGAAGCCCCTCCGGAAGGTCAAATTCTTAACCTTCCGTGAACGACTTGGAGTCATGGAGAGACCCTCTTATGAGGATCCTCTATGA___GAAGG

Fln Alignment:

HA8LWWM01CDRN9___GYSNADWAGSEVDRKSTSGCCFSLGFASISWMSKKQKLVALSIAKAEYIVASLASCEAVWLRRLFSELFGHVLDTTVIFCDNQSGICLSENPVFRDRSKDIDI
Q9M5J7________________GFVDADWVGDLDHIRSTSGYVFNLFGGAISWMSKIQALVALSTTEAEYMVATHASQGSIWLQRLCSGI-GLVQQVVRLDCEIQSAIFMAKNPAYDSKTNHIDV

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain