UniGene Name: sp_v3.0_unigene159493
Length: 233 nt
![]() |
---|
>sp_v3.0_unigene159493
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | disease resistance N like protein [Arabidopsis thaliana] emb|CAB78479.1| disease resistance N like protein [Arabidopsis thaliana] | - | - | 3.0e-09 | 61% |
FL-Next | tr=Uncharacterized protein; Glycine max (Soybean) (Glycine hispida). | - | - | 0.0 | 52% |
Source | Gene names |
---|---|
Sma3 | AT4g14370; At4g14370; GSVIVT00022255001; GSVIVT00029144001; POPTRDRAFT_1087666; POPTRDRAFT_829697; RCOM_0835650; dl3225c; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intrinsic to membrane | GO:0031224 | Cellular Component | 0.0 | - |
Sma3 | transmembrane signaling receptor activity | GO:0004888 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | nucleoside-triphosphatase activity | GO:0017111 | Molecular Function | 0.0 | - |
Sma3 | apoptotic process | GO:0006915 | Biological Process | 0.0 | - |
Sma3 | signal transduction | GO:0007165 | Biological Process | 0.0 | - |
Sma3 | innate immune response | GO:0045087 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Toll/interleukin-1 receptor homology (TIR) domain | IPR000157 | - | 0.0 | - |
Sma3 | Zinc finger, FYVE-type | IPR000306 | - | 0.0 | - |
Sma3 | Regulator of chromosome condensation, RCC1 | IPR000408 | - | 0.0 | - |
Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
Sma3 | Pleckstrin homology domain | IPR001849 | - | 0.0 | - |
Sma3 | NB-ARC | IPR002182 | - | 0.0 | - |
Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
Sma3 | Regulator of chromosome condensation/beta-lactamase-inhibitor protein II | IPR009091 | - | 0.0 | - |
Sma3 | Leucine-rich repeat 3 | IPR011713 | - | 0.0 | - |
Sma3 | Pleckstrin homology-like domain | IPR011993 | - | 0.0 | - |
Sma3 | Brevis radix-like domain | IPR013591 | - | 0.0 | - |
Sma3 | Zinc finger, FYVE-related | IPR017455 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G19420.2 | - | 2.0e-16 | 50% |
RefSeq | Arabidopsis thaliana | NP_197443.3 | regulator of chromosome condensation-like protein with FYVE zinc finger domain [Arabidopsis thaliana] | 2.0e-16 | 50% |
RefSeq | Populus trichocarpa | XP_002313993.1 | predicted protein [Populus trichocarpa] | 1.0e-17 | 52% |
![]() |
---|
Fln status: Putative N-terminus
Fln database: tr_plants
Fln subject: I1N146
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 940 aas, Unexpected STOP codon in 5 prime region, your sequence is shorter than subject: 63 - 1042
Fln protein:
G
Protein Length:
64
Fln nts:
C
Fln Alignment:
HA8LWWM01A4WRV___KGAYLLKCGRKGKLMFCPFKLSK------------------------------AIFQRYPWPEKEYQSFSLIYNDRSLDLVC
I1N146________________KGAYLLKYGRRGKPKFCPFRLSNDESILIWFSGKEEKRLKLTNVSRIISGQRTPIFQRYPRPEKEYQSFSLIYNDRSLDLIC
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain