SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene159445

Length: 391 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>sp_v3.0_unigene159445
CGAGATTTGGTCTTATGGACTTCAATGATTGTAGGATATGCAATGCATGGGTGTGGTAACCAAGCCATTCAACTCTTTGAACAGATGCGAAATTCTGGTACAAAACCAGATTATATCACCTTTGTCGGTGTTCTATCTGCATGCTGCCATGCAGGTTTGGTGAATGAAGGTCGACGATACTTTGAACTTATGAGTGAATATTATCACATCATTCCTAGGATGGAGCACTATTGCTGCATGGTTGATCTTCTTGGCCGTGCAGGGTACTTGGATGAGGTGCAAGACTTTATCAACAACATGCCAATAAAACCTGACATTGCTGTGTGGGGATCTTTACTTGGAGCTTGTAGGATCCATACTAATGTAGAGCTAGGAAAACGTGTTGCTGAAC

Ace file of the UniGene sp_v3.0_unigene159445 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	pentatricopeptide repeat-containing protein [Arabidopsis thaliana] sp\|Q9SHZ8.1\|PP168_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g22070 gb\|AAD25817.1\| hypothetical protein [Arabidopsis thaliana] gb\|AEC07259.1\| pentatricopeptide repe	-	-	1.99965e-42	59%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	70%
Sma3	Putative pentatricopeptide (PPR) repeat-containing protein	-	-	4.908e-09	-

Source	Gene names
Sma3	At1g74600; At2g01510; At2g13600; At2g22070; At2g37320; At3g16610; At3g49170; At4g02750; At5g09950; At5g40410; At5g48910; B1032F05.19; B1358B12.23; EMB2261; F1M20.28; F2I9.13; F2K15.30; F3G5.11; GSVIVT00000138001; GSVIVT00000282001; GSVIVT00000887001; GSVI

Source	GOs	Term	Type	Identity
Sma3	intracellular	GO:0005622	Cellular Component	-
Sma3	mitochondrion	GO:0005739	Cellular Component	-
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	nucleic acid binding	GO:0003676	Molecular Function	-
Sma3	ubiquitin thiolesterase activity	GO:0004221	Molecular Function	-
Sma3	protein serine/threonine kinase activity	GO:0004674	Molecular Function	-
Sma3	binding	GO:0005488	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	methyltransferase activity	GO:0008168	Molecular Function	-
Sma3	protein phosphorylation	GO:0006468	Biological Process	-
Sma3	ubiquitin-dependent protein catabolic process	GO:0006511	Biological Process	-
Sma3	metabolic process	GO:0008152	Biological Process	-
Sma3	embryo development ending in seed dormancy	GO:0009793	Biological Process	-
Sma3	methylation	GO:0032259	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	PAK-box/P21-Rho-binding	IPR000095	-	-
Sma3	Peptidase S8/S53, subtilisin/kexin/sedolisin	IPR000209	-	-
Sma3	Protein kinase, catalytic domain	IPR000719	-	-
Sma3	Beta-lactamase, class-A/D	IPR000871	-	-
Sma3	Peptidase C12, ubiquitin carboxyl-terminal hydrolase 1	IPR001578	-	-
Sma3	DNA methylase, N-6 adenine-specific, conserved site	IPR002052	-	-
Sma3	Pentatricopeptide repeat	IPR002885	-	-
Sma3	Immunoglobulin/major histocompatibility complex, conserved site	IPR003006	-	-
Sma3	Putative methylase	IPR004557	-	-
Sma3	Uncharacterised protein family UPF0497, trans-membrane plant	IPR006702	-	-
Sma3	Methyltransferase small	IPR007848	-	-
Sma3	Serine/threonine-protein kinase, active site	IPR008271	-	-
Sma3	Tetratricopeptide-like helical	IPR011990	-	-
Sma3	EGF-like region, conserved site	IPR013032	-	-
Sma3	Methyltransferase type 11	IPR013216	-	-
Sma3	Protein kinase, ATP binding site	IPR017441	-	-
Sma3		IPR017442	-	-
Sma3	Thioredoxin, conserved site	IPR017937	-	-
Sma3	Asp/Glu racemase, active site	IPR018187	-	-
Sma3	WD40 repeat, conserved site	IPR019775	-	-

Source	Species	ID	Description	Identity
ATG	Arabidoptis thaliana	AT2G22070.1	pentatricopeptide (PPR) repeat-containing protein chr2:9383602-9385962 FORWARD LENGTH=786	59%
RefSeq	Arabidopsis thaliana	NP_179798.1	pentatricopeptide repeat-containing protein [Arabidopsis thaliana]	59%
RefSeq	Populus trichocarpa	XP_002310592.1	predicted protein [Populus trichocarpa]	57%

Full-Lengther Next Prediction

Fln status: Putative C-terminus

Fln database: coniferopsida.fasta

Fln subject: D5AB53

Fln msg: STOP codon was not found. Distance to subject end: 9 aas, your sequence is shorter than subject: 130 - 232

Fln protein: RDLVLWTSMIVGYAMHGCGNQAIQLFEQMRNSGTKPDYITFVGVLSACCHAGLVNEGRRYFELMSEYYHIIPRMEHYCCMVDLLGRAGYLDEVQDFINNMPIKPDIAVWGSLLGACRIHTNVELGKRVAE

Protein Length: 131

Fln nts: CGAGATTTGGTCTTATGGACTTCAATGATTGTAGGATATGCAATGCATGGGTGTGGTAACCAAGCCATTCAACTCTTTGAACAGATGCGAAATTCTGGTACAAAACCAGATTATATCACCTTTGTCGGTGTTCTATCTGCATGCTGCCATGCAGGTTTGGTGAATGAAGGTCGACGATACTTTGAACTTATGAGTGAATATTATCACATCATTCCTAGGATGGAGCACTATTGCTGCATGGTTGATCTTCTTGGCCGTGCAGGGTACTTGGATGAGGTGCAAGACTTTATCAACAACATGCCAATAAAACCTGACATTGCTGTGTGGGGATCTTTACTTGGAGCTTGTAGGATCCATACTAATGTAGAGCTAGGAAAACGTGTTGCTGAAC

Fln Alignment:

HA8LWWM01D5NJ8___RDLVLWTSMIVGYAMHGCGNQAIQLFEQMRNSGTKPDYITFVGVLSACCHAGLVNEGRRYFELMSEYYHIIPRMEHYCCMVDLLGRAGYLDEVQDFINNMPIKPDIAVWGSLLGACRIHTNVELGKRVAE
D5AB53________________RNVVSWNAMIAAYAIHGCGKQALDLFEQMKHSDTSPNQVTFVGVLSACCHAGLVSEGRQYFNSMSVDYHITPVMEHYCCMVDLLGRTGCLDEAHDFINKMPIEPDTAVWQSLLGACRTHANVDLGEKVAE

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain