UniGene Name: sp_v3.0_unigene159424
Length: 182 nt
![]() |
---|
>sp_v3.0_unigene159424
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Catalase n=1 Tax=Cupriavidus metallidurans CH34 RepID=Q1LBL8_RALME | - | - | 4.0e-26 | 91% |
FL-Next | sp=Catalase; Picea glauca (White spruce) (Pinus glauca). | - | - | 0.0 | 57% |
Sma3 | Catalase | - | - | 0.0 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Catalase. | EC:1.11.1.6 | - | 0.0 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Tryptophan metabolism | 00380 | 0.0 | % | |
Sma3 | Methane metabolism | 00680 | 0.0 | % | |
Sma3 | Metabolic pathways | 01100 | 0.0 | % |
Source | Gene names |
---|---|
Sma3 | AT4G35090; At1g20630; At4g35090; At4g35090/M4E13.140; CAT; CAT-1; CAT1; CAT2; CAT3; CAT4; CATA2; Cat1; CatC; F2D10.11; F5M15.31; LOC_Os03g03910; M4E13.140; Os03g0131200; OsI_09857; OsJ_09293; PHATRDRAFT_22418; PHYPADRAFT_223469; PHYPADRAFT_227480; PHYPADR |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | peroxisome | GO:0005777 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | glyoxysome | GO:0009514 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | cytosolic ribosome | GO:0022626 | Cellular Component | 0.0 | - |
Sma3 | catalase activity | GO:0004096 | Molecular Function | 0.0 | - |
Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
Sma3 | cellular response to nitrogen starvation | GO:0006995 | Biological Process | 0.0 | - |
Sma3 | response to light stimulus | GO:0009416 | Biological Process | 0.0 | - |
Sma3 | response to abscisic acid stimulus | GO:0009737 | Biological Process | 0.0 | - |
Sma3 | cellular response to sulfate starvation | GO:0009970 | Biological Process | 0.0 | - |
Sma3 | cellular response to phosphate starvation | GO:0016036 | Biological Process | 0.0 | - |
Sma3 | hydrogen peroxide catabolic process | GO:0042744 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Catalase haem-binding site | IPR002226 | - | 0.0 | - |
Sma3 | Catalase immune-responsive domain | IPR010582 | - | 0.0 | - |
Sma3 | Catalase core domain | IPR011614 | - | 0.0 | - |
Sma3 | Catalase, mono-functional, haem-containing | IPR018028 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G20630.1 | CAT1 catalase 1 chr1:7146812-7149609 FORWARD LENGTH=492 | 1.0e-17 | 62% |
RefSeq | Arabidopsis thaliana | NP_564121.1 | catalase 1 [Arabidopsis thaliana] | 2.0e-17 | 62% |
RefSeq | Populus trichocarpa | XP_002301920.1 | catalase [Populus trichocarpa] | 7.0e-16 | 58% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8YBE1
Fln msg: Distance to subject end: 401 aas, your sequence is shorter than subject: 60 - 492
Fln protein:
Q
Protein Length:
61
Fln nts:
T
Fln Alignment:
HLKU4M004JBL7F___TAGPRGPVLLQDFWFLEKMAHFDREVIPERRMHAKGSGAYGTFTVTHDITKYTRADL
B8YBE1________________TIGSRGPILLEDYHLVEKIAQFDRERVPERVVHARGASAKGFFEVTHDISHLTCADL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain