UniGene Name: sp_v3.0_unigene159408
Length: 183 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene159408
C |
Ace file of the UniGene sp_v3.0_unigene159408
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Calcium-transporting ATPase (Fragment) n=1 Tax=Chlamydomonas reinhardtii RepID=A8HM60_CHLRE | - | - | 2.0e-14 | 69% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 60% |
| Sma3 | Autoinhibited calcium ATPase | - | - | 7.82e-26 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Calcium-transporting ATPase. | EC:3.6.3.8 | - | 0.0 | - |
| Source | Gene names |
|---|---|
| Sma3 | ACA1; ACA10; ACA11; ACA12; ACA2; ACA4; ACA7; ACA8; AT5G57110; At1g27770; At2g22950; At2g41560; At3g57330; At3g63380; At3g63380/MAA21_10; At4g29900; At4g37640; At5g57110; B1150F11.11; CA1; CA2; CA4; CHLREDRAFT_116583; CHLREDRAFT_118223; CHLREDRAFT_128099; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plant-type vacuole | GO:0000325 | Cellular Component | 0.0 | - |
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | vacuolar membrane | GO:0005774 | Cellular Component | 0.0 | - |
| Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
| Sma3 | endoplasmic reticulum membrane | GO:0005789 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast inner membrane | GO:0009706 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | flagellum | GO:0019861 | Cellular Component | 0.0 | - |
| Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
| Sma3 | damaged DNA binding | GO:0003684 | Molecular Function | 0.0 | - |
| Sma3 | DNA-directed DNA polymerase activity | GO:0003887 | Molecular Function | 0.0 | - |
| Sma3 | calcium channel activity | GO:0005262 | Molecular Function | 0.0 | - |
| Sma3 | calcium-transporting ATPase activity | GO:0005388 | Molecular Function | 0.0 | - |
| Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
| Sma3 | calmodulin binding | GO:0005516 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism | GO:0015662 | Molecular Function | 0.0 | - |
| Sma3 | protein self-association | GO:0043621 | Molecular Function | 0.0 | - |
| Sma3 | DNA repair | GO:0006281 | Biological Process | 0.0 | - |
| Sma3 | ATP biosynthetic process | GO:0006754 | Biological Process | 0.0 | - |
| Sma3 | cation transport | GO:0006812 | Biological Process | 0.0 | - |
| Sma3 | calcium ion transport | GO:0006816 | Biological Process | 0.0 | - |
| Sma3 | response to nematode | GO:0009624 | Biological Process | 0.0 | - |
| Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
| Sma3 | inflorescence morphogenesis | GO:0048281 | Biological Process | 0.0 | - |
| Sma3 | shoot development | GO:0048367 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | ATPase, P-type, H+ transporting proton pump | IPR000695 | - | 0.0 | - |
| Sma3 | DNA-repair protein, UmuC-like | IPR001126 | - | 0.0 | - |
| Sma3 | ATPase, P-type, K/Mg/Cd/Cu/Zn/Na/Ca/Na/H-transporter | IPR001757 | - | 0.0 | - |
| Sma3 | ATPase, P-type cation-transporter, N-terminal | IPR004014 | - | 0.0 | - |
| Sma3 | Haloacid dehalogenase-like hydrolase | IPR005834 | - | 0.0 | - |
| Sma3 | ATPase, P-type cation-transporter, C-terminal | IPR006068 | - | 0.0 | - |
| Sma3 | ATPase, P-type cation exchange, alpha subunit | IPR006069 | - | 0.0 | - |
| Sma3 | ATPase, P-type, calcium-transporting, PMCA-type | IPR006408 | - | 0.0 | - |
| Sma3 | ATPase, P-type, ATPase-associated domain | IPR008250 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | DNA-repair protein, UmuC-like, N-terminal | IPR017963 | - | 0.0 | - |
| Sma3 | ATPase, P-type phosphorylation site | IPR018303 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G27770.1 | ACA1, PEA1 autoinhibited Ca2+-ATPase 1 chr1:9671912-9676010 REVERSE LENGTH=1020 | 1.0e-16 | 67% |
| RefSeq | Arabidopsis thaliana | NP_564295.1 | autoinhibited Ca2+-ATPase 1 [Arabidopsis thaliana] | 2.0e-16 | 67% |
| RefSeq | Populus trichocarpa | XP_002320033.1 | predicted protein [Populus trichocarpa] | 8.0e-17 | 66% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AEG4
Fln msg: Distance to subject end: 288 aas, your sequence is shorter than subject: 60 - 387
Fln protein:
K
Protein Length:
61
Fln nts:
C
Fln Alignment:
HLKU4M004JF8QZ___SDEEIDRLIPSLQVLARSSPLDKLRLVQRLRANKHVVGVTGDGTNDAAALKEADVGLA
D5AEG4________________SEEERLEIVDKICVMGRSSPTDKLFLVQALRKKGHVVAVTGDGTNDAPALHEADIGLS

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta