UniGene Name: sp_v3.0_unigene159399
Length: 163 nt
![]() |
---|
>sp_v3.0_unigene159399
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | PREDICTED: similar to Spermidine synthase (SPDSY) (Putrescine aminopropyltransferase), partial n=1 Tax=Ciona intestinalis RepID=UPI000180ADB0 | - | - | 1.0e-16 | 76% |
FL-Next | tr=Putative spermidine synthase; Pinus sylvestris (Scots pine). | - | - | 0.0 | 74% |
Sma3 | Spermidine synthase | - | - | 0.0 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Putrescine N-methyltransferase. | EC:2.1.1.53 | - | 9.302e-09 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Tropane, piperidine and pyridine alkaloid biosynthesis | 00960 | 9.302e-09 | % | |
Sma3 | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 9.302e-09 | % | |
Sma3 | Metabolic pathways | 01100 | 9.302e-09 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 9.302e-09 | % | |
Sma3 | Spermidine synthase. | EC:2.5.1.16 | - | 1.27518e-43 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Cysteine and methionine metabolism | 00270 | 1.27518e-43 | % | |
Sma3 | Arginine and proline metabolism | 00330 | 1.27518e-43 | % | |
Sma3 | beta-Alanine metabolism | 00410 | 1.27518e-43 | % | |
Sma3 | Glutathione metabolism | 00480 | 1.27518e-43 | % | |
Sma3 | Metabolic pathways | 01100 | 1.27518e-43 | % |
Source | Gene names |
---|---|
Sma3 | AT5G53120; At1g23820; At1g70310; At5g53120; F17O7.16; F5O8.38; GSVIVT00006512001; GSVIVT00028846001; MICPUCDRAFT_45807; MICPUN_106331; MdSPDS1; MdSPDS2a; MdSPDS2b; OSJNBa0052K15.8-1; OSTLU_26437; Os06g0528600; Os07g0408700; OsI_06609; OsI_23221; OsI_25717 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
Sma3 | spermidine synthase activity | GO:0004766 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | transferase activity | GO:0016740 | Molecular Function | 0.0 | - |
Sma3 | spermine synthase activity | GO:0016768 | Molecular Function | 0.0 | - |
Sma3 | polyamine biosynthetic process | GO:0006596 | Biological Process | 0.0 | - |
Sma3 | spermidine biosynthetic process | GO:0008295 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Spermine synthase | IPR001045 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G70310.1 | SPDS2 spermidine synthase 2 chr1:26485497-26487352 REVERSE LENGTH=340 | 1.0e-19 | 74% |
RefSeq | Arabidopsis thaliana | NP_177188.1 | Spermidine synthase 2 [Arabidopsis thaliana] | 1.0e-19 | 74% |
RefSeq | Populus trichocarpa | XP_002315806.1 | predicted protein [Populus trichocarpa] | 4.0e-20 | 76% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: G8C848
Fln msg: Distance to subject end: 203 aas, your sequence is shorter than subject: 53 - 345
Fln protein:
K
Protein Length:
54
Fln nts:
C
Fln Alignment:
HLKU4M004JFUYC___TYGNVLVLDGVLQLTEKDQFAYQELITHLPLFSHANPEAVCVIGGGDGAVL
G8C848________________TYGKVLVLDGVIQLTERDECAYQEMITHLPLCSVPNPKKVLVIGGGDGGVL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain