UniGene Name: sp_v3.0_unigene159392
Length: 164 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene159392
G |
Ace file of the UniGene sp_v3.0_unigene159392
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Dihydrolipoamide dehydrogenase, putative n=1 Tax=Ricinus communis RepID=B9RZN2_RICCO | - | - | 7.0e-15 | 71% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 71% |
| Sma3 | Dihydrolipoyl dehydrogenase | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Dihydrolipoyl dehydrogenase. | EC:1.8.1.4 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycolysis / Gluconeogenesis | 00010 | 0.0 | % | |
| Sma3 | Citrate cycle (TCA cycle) | 00020 | 0.0 | % | |
| Sma3 | Glycine, serine and threonine metabolism | 00260 | 0.0 | % | |
| Sma3 | Valine, leucine and isoleucine degradation | 00280 | 0.0 | % | |
| Sma3 | Pyruvate metabolism | 00620 | 0.0 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 0.0 | % | |
| Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 0.0 | % | |
| Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 0.0 | % | |
| Sma3 | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 0.0 | % | |
| Sma3 | Biosynthesis of alkaloids derived from histidine and purine | 01065 | 0.0 | % | |
| Sma3 | Biosynthesis of alkaloids derived from terpenoid and polyketide | 01066 | 0.0 | % | |
| Sma3 | Biosynthesis of plant hormones | 01070 | 0.0 | % | |
| Sma3 | Metabolic pathways | 01100 | 0.0 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 0.0 | % |
| Source | Gene names |
|---|---|
| Sma3 | AT3G16950; At3g16950; At4g16155; CHLREDRAFT_205763; DLD2; DLDH2; DLDH2-GCSL2; DLDH2_GCSL2; GSVIVT00022623001; GSVIVT00033119001; LPD3; LPD4; MICPUCDRAFT_34732; MICPUN_104967; MtrDRAFT_AC149491g1v2; OSTLU_15203; Os01g0337900; Os05g0156700; OsI_01744; OsI_1 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
| Sma3 | dihydrolipoyl dehydrogenase activity | GO:0004148 | Molecular Function | 0.0 | - |
| Sma3 | flavin adenine dinucleotide binding | GO:0050660 | Molecular Function | 0.0 | - |
| Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
| Sma3 | cell redox homeostasis | GO:0045454 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Tubulin | IPR000217 | - | 0.0 | - |
| Sma3 | Mercuric reductase | IPR000815 | - | 0.0 | - |
| Sma3 | Pyridine nucleotide-disulphide oxidoreductase, NAD-binding domain | IPR001327 | - | 0.0 | - |
| Sma3 | Gamma tubulin | IPR002454 | - | 0.0 | - |
| Sma3 | Tubulin/FtsZ, GTPase domain | IPR003008 | - | 0.0 | - |
| Sma3 | Pyridine nucleotide-disulphide oxidoreductase, dimerisation | IPR004099 | - | 0.0 | - |
| Sma3 | Dihydrolipoamide dehydrogenase | IPR006258 | - | 0.0 | - |
| Sma3 | Pyridine nucleotide-disulphide oxidoreductase, class I, active site | IPR012999 | - | 0.0 | - |
| Sma3 | FAD-dependent pyridine nucleotide-disulphide oxidoreductase | IPR013027 | - | 0.0 | - |
| Sma3 | Tubulin, conserved site | IPR017975 | - | 0.0 | - |
| Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
| Sma3 | Tubulin/FtsZ, 2-layer sandwich domain | IPR018316 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G16155.1 | dihydrolipoyl dehydrogenases chr4:9153570-9157322 REVERSE LENGTH=630 | 1.0e-19 | 71% |
| RefSeq | Arabidopsis thaliana | NP_567487.4 | dihydrolipoyl dehydrogenase [Arabidopsis thaliana] | 2.0e-19 | 71% |
| RefSeq | Populus trichocarpa | XP_002316024.1 | precursor of dehydrogenase dihydrolipoamide dehydrogenase 4, partial [Populus trichocarpa] | 8.0e-20 | 75% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LKS4
Fln msg: Distance to subject end: 107 aas, your sequence is shorter than subject: 54 - 576
Fln protein:
L
Protein Length:
55
Fln nts:
G
Fln Alignment:
HLKU4M004IRL9K___LAHAASAQGISAIENIVGRPHVINHNNIPAACFSHPEIAMVGLNEDQAK
B8LKS4________________LAHTASAQGISVIEQISGRDNVLNHLSIPAACFTHPEISMVGLTEPQAR

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta