|
||||||
|
UniGene Name: sp_v3.0_unigene159369
Length: 136 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene159369
T |
|
Ace file of the UniGene sp_v3.0_unigene159369
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | putative RNA helicase (ISS) [Ostreococcus tauri] emb|CAL53470.1| putative RNA helicase (ISS) [Ostreococcus tauri] | - | - | 4.0e-10 | 68% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 75% |
| Sma3 | DEAD-box ATP-dependent RNA helicase 6 | - | - | 1.165e-08 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Hydrolases, Acting on acid anhydrides, In phosphorous-containing anhydrides. | EC:3.6.1.- | - | 1.177e-06 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Purine metabolism | 00230 | 1.177e-06 | % | |
| Sma3 | Lipopolysaccharide biosynthesis | 00540 | 1.177e-06 | % | |
| Sma3 | Folate biosynthesis | 00790 | 1.177e-06 | % | |
| Sma3 | Metabolic pathways | 01100 | 1.177e-06 | % |
| Source | Gene names |
|---|---|
| Sma3 | At2g45810; At3g61240; CHLREDRAFT_56005; DEH1; F4I18.21; GSVIVT00000382001; GSVIVT00026802001; LOC_Os02g42860; LOC_Os04g45040; MICPUCDRAFT_29042; MICPUN_60493; OJ1112_G03.6-1; OJ1112_G03.6-2; OSJNBb0039L24.10; OSTLU_49732; Os02g0641800; Os04g0533000; OsI_0 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | ATP-dependent helicase activity | GO:0008026 | Molecular Function | 0.0 | - |
| Sma3 | mRNA processing | GO:0006397 | Biological Process | 0.0 | - |
| Sma3 | regulation of translation | GO:0006417 | Biological Process | 0.0 | - |
| Sma3 | mRNA transport | GO:0051028 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | RNA helicase, ATP-dependent, DEAD-box, conserved site | IPR000629 | - | 0.0 | - |
| Sma3 | Helicase, C-terminal | IPR001650 | - | 0.0 | - |
| Sma3 | DNA/RNA helicase, DEAD/DEAH box type, N-terminal | IPR011545 | - | 0.0 | - |
| Sma3 | Helicase, superfamily 1/2, ATP-binding domain | IPR014001 | - | 0.0 | - |
| Sma3 | RNA helicase, DEAD-box type, Q motif | IPR014014 | - | 0.0 | - |
| Sma3 | IPR014021 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G45810.1 | DEA(D/H)-box RNA helicase family protein chr2:18859836-18862318 FORWARD LENGTH=528 | 9.0e-13 | 66% |
| RefSeq | Arabidopsis thaliana | NP_182105.1 | DEAD-box ATP-dependent RNA helicase 6 [Arabidopsis thaliana] | 1.0e-12 | 66% |
| RefSeq | Populus trichocarpa | XP_002301349.1 | predicted protein [Populus trichocarpa] | 3.0e-14 | 68% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LKI3
Fln msg: Distance to subject end: 207 aas, your sequence is shorter than subject: 45 - 477
Fln protein:
V
Protein Length:
46
Fln nts:
T
Fln Alignment:
HLKU4M004I3ICM___VATPGRVLDLAKRGVADLSKCEMLVMDEADKLLSPEFQSLLGQII
B8LKI3________________VATPGRVLDLTKKGVCNLKDCAMLVMDEADKLLSPEFQPLVEQLI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
