UniGene Name: sp_v3.0_unigene159292
Length: 222 nt
![]() |
---|
>sp_v3.0_unigene159292
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | ATPase n=1 Tax=Capsaspora owczarzaki ATCC 30864 RepID=E9C2J2_9EUKA | - | - | 1.0e-29 | 86% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 82% |
Sma3 | Vacuolar ATP synthase catalytic subunit A | - | - | 1.467e-08 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Transferred entry: 3.6.3.14. | EC:3.6.1.34 | - | 9.215e-06 | - |
Source | Gene names |
---|---|
Sma3 | AT1G78900; ATPvA1; At1g78900; CHLREDRAFT_54608; CVA69.24; Cit-VATP A-1; GSVIVT00029622001; GSVIVT00032341001; HVA/68; MICPUCDRAFT_43849; MICPUN_59806; NaVHA1; OJ1077_E05.10; OSJNBa0051O02.43; OSJNBb0065C04.10; OSTLU_50597; Os02g0175400; Os06g0662000; OsI_ |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plant-type vacuole | GO:0000325 | Cellular Component | 0.0 | - |
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | proton-transporting two-sector ATPase complex, catalytic domain | GO:0033178 | Cellular Component | 0.0 | - |
Sma3 | proton-transporting V-type ATPase, V1 domain | GO:0033180 | Cellular Component | 0.0 | - |
Sma3 | nucleotide binding | GO:0000166 | Molecular Function | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | helicase activity | GO:0004386 | Molecular Function | 0.0 | - |
Sma3 | endonuclease activity | GO:0004519 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances | GO:0016820 | Molecular Function | 0.0 | - |
Sma3 | hydrogen ion transporting ATP synthase activity, rotational mechanism | GO:0046933 | Molecular Function | 0.0 | - |
Sma3 | proton-transporting ATPase activity, rotational mechanism | GO:0046961 | Molecular Function | 0.0 | - |
Sma3 | ATP synthesis coupled proton transport | GO:0015986 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | ATPase, F1/V1/A1 complex, alpha/beta subunit, nucleotide-binding domain | IPR000194 | - | 0.0 | - |
Sma3 | SNF2-related | IPR000330 | - | 0.0 | - |
Sma3 | ATPase, F1/V1/A1 complex, alpha/beta subunit, C-terminal | IPR000793 | - | 0.0 | - |
Sma3 | Helicase, C-terminal | IPR001650 | - | 0.0 | - |
Sma3 | HNH endonuclease | IPR002711 | - | 0.0 | - |
Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
Sma3 | HNH nuclease | IPR003615 | - | 0.0 | - |
Sma3 | ATPase, F1/V1/A1 complex, alpha/beta subunit, N-terminal | IPR004100 | - | 0.0 | - |
Sma3 | ATPase, V1 complex, subunit A | IPR005725 | - | 0.0 | - |
Sma3 | Helicase, superfamily 1/2, ATP-binding domain | IPR014001 | - | 0.0 | - |
Sma3 | IPR014021 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G78900.1 | VHA-A vacuolar ATP synthase subunit A chr1:29660463-29664575 FORWARD LENGTH=623 | 6.0e-36 | 84% |
RefSeq | Arabidopsis thaliana | NP_001031299.1 | V-type proton ATPase catalytic subunit A [Arabidopsis thaliana] | 7.0e-36 | 84% |
RefSeq | Populus trichocarpa | XP_002310927.1 | predicted protein [Populus trichocarpa] | 4.0e-35 | 83% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5A887
Fln msg: Distance to subject end: 178 aas, your sequence is shorter than subject: 73 - 623
Fln protein:
P
Protein Length:
74
Fln nts:
G
Fln Alignment:
HLKU4M004IX7S6___PADSGYPAYLGARLASFYERAGKADCIGNPTRNGSVTIVGAVSPQGGDMSEPVTSATLGIVQVFWQLDKKLAQ
D5A887________________PADSGYPAYLAARLASFYERAGKVKCLGSPDRTGSVTIVGAVSPPGGDFSDPVTAATLGIVQAFWGLDKKLAQ
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain