UniGene Name: sp_v3.0_unigene159254
Length: 235 nt
![]() |
---|
>sp_v3.0_unigene159254
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Protein disulfide-isomerase 1 n=1 Tax=Dictyostelium discoideum RepID=PDI1_DICDI | - | - | 2.0e-21 | 58% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 53% |
Sma3 | Probable protein disulfide-isomerase A6 | - | - | 1.712e-08 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein disulfide-isomerase. | EC:5.3.4.1 | - | 7.183e-11 | - |
Source | Gene names |
---|---|
Sma3 | AT2G47470; At2g47470; B1088D01.21; Os01g0339900; Os05g0156300; OsI_01755; OsI_18529; OsJ_01619; OsJ_17181; P0431G05.14; P0676G05.4; PDI; PDIL2-1; PDIL2-2; RCOM_1347720; T30B22.23; pdi; pdi23; trx; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
Sma3 | endoplasmic reticulum lumen | GO:0005788 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
Sma3 | protein disulfide isomerase activity | GO:0003756 | Molecular Function | 0.0 | - |
Sma3 | isomerase activity | GO:0016853 | Molecular Function | 0.0 | - |
Sma3 | double fertilization forming a zygote and endosperm | GO:0009567 | Biological Process | 0.0 | - |
Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
Sma3 | response to endoplasmic reticulum stress | GO:0034976 | Biological Process | 0.0 | - |
Sma3 | cell redox homeostasis | GO:0045454 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Disulphide isomerase | IPR005788 | - | 0.0 | - |
Sma3 | Protein disulphide isomerase | IPR005792 | - | 0.0 | - |
Sma3 | IPR006662 | - | 0.0 | - | |
Sma3 | Endoplasmic reticulum, protein ERp29, C-terminal | IPR011679 | - | 0.0 | - |
Sma3 | IPR012335 | - | 0.0 | - | |
Sma3 | Thioredoxin domain | IPR013766 | - | 0.0 | - |
Sma3 | IPR017936 | - | 0.0 | - | |
Sma3 | Thioredoxin, conserved site | IPR017937 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G47470.1 | ATPDIL2-1, UNE5, MEE30, PDI11, ATPDI11 thioredoxin family protein chr2:19481503-19483683 FORWARD LENGTH=361 | 5.0e-24 | 53% |
RefSeq | Arabidopsis thaliana | NP_973708.1 | protein disulfide-isomerase A6 [Arabidopsis thaliana] | 4.0e-24 | 53% |
RefSeq | Populus trichocarpa | XP_002320314.1 | predicted protein [Populus trichocarpa] | 4.0e-23 | 50% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PRU9
Fln msg: Distance to subject end: 157 aas, your sequence is shorter than subject: 78 - 359
Fln protein:
I
Protein Length:
79
Fln nts:
C
Fln Alignment:
HLKU4M004H1VWX___INSKTGLKARVKKAPSSVVELNDENFDDIVLDSKKHVFVEFFAPWCGHCKKLAPEWEKLGHVFANEEEVVIAKYDAD
C0PRU9________________VNTEGGINVKVTVPTSEVVVLTSENFDSVVLDESKDVLVEFYAPWCGHCKNLAPTYEKVATAFKSEKDVVIANVDAD
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain