|
||||||
|
UniGene Name: sp_v3.0_unigene159192
Length: 175 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene159192
A |
|
Ace file of the UniGene sp_v3.0_unigene159192
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | DNA-directed RNA polymerase subunit beta' n=1 Tax=Chitinophaga pinensis DSM 2588 RepID=C7PUG7_CHIPD | - | - | 6.0e-24 | 94% |
| FL-Next | sp=DNA-directed RNA polymerase; Abies firma (Momi fir). Plastid; Chloroplast. | - | - | 0.0 | 74% |
| Sma3 | DNA-directed RNA polymerase subunit beta' | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | DNA-directed RNA polymerase. | EC:2.7.7.6 | - | 3.902e-40 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Purine metabolism | 00230 | 3.902e-40 | % | |
| Sma3 | Pyrimidine metabolism | 00240 | 3.902e-40 | % | |
| Sma3 | Metabolic pathways | 01100 | 3.902e-40 | % |
| Source | Gene names |
|---|---|
| Sma3 | CLPGMS-2216; Grc000137; MicpuC_chl3; OtCpg00270; rpoC; rpoC1; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | plastid | GO:0009536 | Cellular Component | 0.0 | - |
| Sma3 | cyanelle | GO:0009842 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | DNA-directed RNA polymerase activity | GO:0003899 | Molecular Function | 0.0 | - |
| Sma3 | GO:0006350 | Biological Process | 0.0 | - | |
| Sma3 | transcription, DNA-dependent | GO:0006351 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | RNA polymerase, alpha subunit | IPR000722 | - | 0.0 | - |
| Sma3 | RNA polymerase, N-terminal | IPR006592 | - | 0.0 | - |
| Sma3 | RNA polymerase Rpb1, domain 3 | IPR007066 | - | 0.0 | - |
| Sma3 | RNA polymerase Rpb1, domain 1 | IPR007080 | - | 0.0 | - |
| Sma3 | RNA polymerase Rpb1, domain 5 | IPR007081 | - | 0.0 | - |
| Sma3 | RNA polymerase Rpb1, domain 4 | IPR007083 | - | 0.0 | - |
| Sma3 | DNA-directed RNA polymerase, subunit beta-prime | IPR012754 | - | 0.0 | - |
| Sma3 | DNA-directed RNA polymerase, subunit gamma | IPR012755 | - | 0.0 | - |
| Sma3 | DNA-directed RNA polymerase, subunit beta'' | IPR012756 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | ATCG00180.1 | RPOC1 DNA-directed RNA polymerase family protein chrC:20251-23084 REVERSE LENGTH=680 | 4.0e-20 | 70% |
| RefSeq | Populus trichocarpa | YP_001109490.1 | RNA polymerase beta' subunit (chloroplast) [Populus trichocarpa] | 2.0e-19 | 72% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C3VZB6
Fln msg: Distance to subject end: 161 aas, your sequence is shorter than subject: 58 - 696
Fln protein:
I
Protein Length:
59
Fln nts:
A
Fln Alignment:
HLKU4M004I54F5___IQAFQPKLIEGKAIQLHPLVCTAFNADFDGDQMAVHVPLSSAAILEAQLLMLSSHNIL
C3VZB6________________IQAFQPILVEGRAIRLHPLVCGGFNADFDGDQMAVHVPLSLEARAEARLLMFSEKNLL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
