UniGene Name: sp_v3.0_unigene159182
Length: 140 nt
UniGene Fasta |
---|
>sp_v3.0_unigene159182
C |
Ace file of the UniGene sp_v3.0_unigene159182 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | vacuolar H+ ATPase B subunit [Dictyostelium discoideum AX4] sp|Q76NU1.1|VATB_DICDI RecName: Full=V-type proton ATPase subunit B; Short=V-ATPase subunit B; AltName: Full=Vacuolar proton pump subunit B gb|EAL68663.1| vacuolar H+ ATPase B subunit [Dictyostel | - | - | 6.0e-14 | 80% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 69% |
Sma3 | ATP synthase subunit beta vacuolar, putative | - | - | 1.751e-08 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Sodium-transporting two-sector ATPase. | EC:3.6.3.15 | - | 2.989e-06 | - |
Source | Gene names |
---|---|
Sma3 | AT57; ATPvB; At1g20260; At1g76030; At4g38510; B1142C05.1; CHLREDRAFT_126382; Cit-VATP B-1; CitVATP B-1; F14O10.13; F20M13.70; GSVIVT00015498001; GSVIVT00036158001; MICPUCDRAFT_45455; MICPUN_55906; OSJNBa0062E01.5; OSTLU_88387; Os01g0711000; Os06g0568200; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | proton-transporting two-sector ATPase complex, catalytic domain | GO:0033178 | Cellular Component | 0.0 | - |
Sma3 | proton-transporting V-type ATPase, V1 domain | GO:0033180 | Cellular Component | 0.0 | - |
Sma3 | hydrogen ion transporting ATP synthase activity, rotational mechanism | GO:0046933 | Molecular Function | 0.0 | - |
Sma3 | proton-transporting ATPase activity, rotational mechanism | GO:0046961 | Molecular Function | 0.0 | - |
Sma3 | ATP synthesis coupled proton transport | GO:0015986 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | ATPase, F1/V1/A1 complex, alpha/beta subunit, nucleotide-binding domain | IPR000194 | - | 0.0 | - |
Sma3 | ATPase, F1/V1/A1 complex, alpha/beta subunit, C-terminal | IPR000793 | - | 0.0 | - |
Sma3 | ATPase, F1/V1/A1 complex, alpha/beta subunit, N-terminal | IPR004100 | - | 0.0 | - |
Sma3 | ATPase, V1 complex, subunit B | IPR005723 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G76030.1 | ATPase, V1 complex, subunit B protein chr1:28534134-28536916 FORWARD LENGTH=486 | 9.0e-16 | 75% |
RefSeq | Arabidopsis thaliana | NP_177729.1 | V-type proton ATPase subunit B1 [Arabidopsis thaliana] | 1.0e-15 | 75% |
RefSeq | Populus trichocarpa | XP_002313695.1 | predicted protein [Populus trichocarpa] | 4.0e-15 | 72% |
Full-Lengther Next Prediction |
---|
Fln status: Putative N-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NVU9
Fln msg: Distance to subject end: 425 aas, atg_distance in limit (1-15): atg_distance = 15, W2: There is no M at the beginning, your sequence is shorter than subject: 46 - 486
Fln protein:
P
Protein Length:
47
Fln nts:
C
Fln Alignment:
HLKU4M004JFNF9___PRLDYRTVTGVNGPLVILDNIKLPKYAEIVNLTLGDGSRRRGQVLE
A9NVU9________________PLIEYRTVSGVAGPLVILEKVKGPKYQEIVNIRLGDGTTRRGQVLE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain