|
||||||
|
UniGene Name: sp_v3.0_unigene159065
Length: 205 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene159065
T |
|
Ace file of the UniGene sp_v3.0_unigene159065
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Acetyltransferase (Fragment) n=6 Tax=Panarthropoda RepID=D0UKN6_9MYRI | - | - | 2.0e-19 | 74% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 78% |
| Sma3 | Silencing group B protein | - | - | 1.538e-11 | - |
| Source | Gene names |
|---|---|
| Sma3 | At5g13780; CHLREDRAFT_95444; GSVIVT00028699001; H0410G08.10; MICPUCDRAFT_20989; MICPUN_73117; MXE10.5; NAT1; OSJNBa0043L09.27; OSTLU_7944; Os04g0635800; OsI_17581; OsI_17596; OsJ_16314; Ot06g04790; PHATRDRAFT_51345; PHYPADRAFT_116602; PHYPADRAFT_197972; P |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | ATP-dependent helicase activity | GO:0008026 | Molecular Function | 0.0 | - |
| Sma3 | N-acetyltransferase activity | GO:0008080 | Molecular Function | 0.0 | - |
| Sma3 | pyridoxal phosphate binding | GO:0030170 | Molecular Function | 0.0 | - |
| Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | GNAT domain | IPR000182 | - | 0.0 | - |
| Sma3 | RNA helicase, ATP-dependent, DEAD-box, conserved site | IPR000629 | - | 0.0 | - |
| Sma3 | Helicase, C-terminal | IPR001650 | - | 0.0 | - |
| Sma3 | B30.2/SPRY domain | IPR001870 | - | 0.0 | - |
| Sma3 | SPla/RYanodine receptor SPRY | IPR003877 | - | 0.0 | - |
| Sma3 | Aluminium resistance | IPR009651 | - | 0.0 | - |
| Sma3 | DNA/RNA helicase, DEAD/DEAH box type, N-terminal | IPR011545 | - | 0.0 | - |
| Sma3 | Helicase, superfamily 1/2, ATP-binding domain | IPR014001 | - | 0.0 | - |
| Sma3 | RNA helicase, DEAD-box type, Q motif | IPR014014 | - | 0.0 | - |
| Sma3 | IPR014021 | - | 0.0 | - | |
| Sma3 | Pyridoxal phosphate-dependent transferase, major region, subdomain 1 | IPR015421 | - | 0.0 | - |
| Sma3 | Acyl-CoA N-acyltransferase | IPR016181 | - | 0.0 | - |
| Sma3 | SPla/RYanodine receptor subgroup | IPR018355 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G13780.1 | Acyl-CoA N-acyltransferases (NAT) superfamily protein chr5:4447610-4448603 REVERSE LENGTH=192 | 3.0e-23 | 77% |
| RefSeq | Arabidopsis thaliana | NP_196882.1 | peptide alpha-N-acetyltransferase [Arabidopsis thaliana] | 4.0e-23 | 77% |
| RefSeq | Populus trichocarpa | XP_002314058.1 | silencing group B protein [Populus trichocarpa] | 3.0e-23 | 78% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NSV4
Fln msg: Distance to subject end: 66 aas, your sequence is shorter than subject: 67 - 192
Fln protein:
E
Protein Length:
68
Fln nts:
T
Fln Alignment:
HLKU4M004J065E___HGHITSLAVLRSHRKLGLATKLMTQSQRAMLDGFNAEYVSLHVRKSNRAALGLYSET
A9NSV4________________HGHITSLAVLRTHRKLGLATKLMTAAQKAMHEVFGAEYVSLHVRKSNRAAFHLYTQT
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
