SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene158943

Length: 263 nt

UniGene Fasta

>sp_v3.0_unigene158943
ACAAACTCACTTAAACCTTCCAATTTTCAACTCTGTTAAGGAGGCCAAAGCCGCCACTAAATGCGAGGCGTCTGTTATCTACGTTCCTCCTCCTTTTGCTGGTGCCGCTATTCACGAAGCCATTGACGCTGAAATTGAACTCGTTGTTTGCATCACCGAAGGAATTCCTCAGAGAGACATGGTAAAGGTGAAAAAGCGCCTTCTCGGACAAACAAAGACACGTTTAATCGGACCCAACTGCCCAGGAATCATTAAGCCAGGAG

Ace file of the UniGene sp_v3.0_unigene158943

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Succinyl-CoA ligase n=2 Tax=Chlamydomonadales RepID=A8IWJ8_CHLRE	-	-	8.0e-27	68%
FL-Next	sp=Probable succinyl-CoA ligase [ADP-forming] subunit alpha, mitochondrial; Oryza sativa subsp. japonica (Rice).	-	-	0.0	78%

Source	ECs	Term	Type	e value	Identity
Sma3	Succinate--CoA ligase (GDP-forming).	EC:6.2.1.4	-	3.601e-20	-

Source	KEGGs	Term	e value	Identity
Sma3	Citrate cycle (TCA cycle)	00020	3.601e-20	%
Sma3	Propanoate metabolism	00640	3.601e-20	%
Sma3	Biosynthesis of phenylpropanoids	01061	3.601e-20	%
Sma3	Biosynthesis of terpenoids and steroids	01062	3.601e-20	%
Sma3	Biosynthesis of alkaloids derived from shikimate pathway	01063	3.601e-20	%
Sma3	Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid	01064	3.601e-20	%
Sma3	Biosynthesis of alkaloids derived from histidine and purine	01065	3.601e-20	%
Sma3	Biosynthesis of alkaloids derived from terpenoid and polyketide	01066	3.601e-20	%
Sma3	Biosynthesis of plant hormones	01070	3.601e-20	%
Sma3	Metabolic pathways	01100	3.601e-20	%
Sma3	Biosynthesis of secondary metabolites	01110	3.601e-20	%

Source	Gene names
Sma3	At5g08300; At5g23250; CHLREDRAFT_196570; F8L15_30; GSVIVT00031891001; GSVIVT00037069001; MICPUCDRAFT_45127; MICPUN_54789; MKD15.11; OSTLU_30915; Os07g0577700; OsI_26601; OsJ_24862; Ot03g05850; PHATRDRAFT_42015; PHYPADRAFT_148732; PHYPADRAFT_209911; PHYPAD

Source	GOs	Term	Type	Identity
Sma3	cell wall	GO:0005618	Cellular Component	-
Sma3	mitochondrion	GO:0005739	Cellular Component	-
Sma3	catalytic activity	GO:0003824	Molecular Function	-
Sma3	ATP citrate synthase activity	GO:0003878	Molecular Function	-
Sma3	succinate-CoA ligase (ADP-forming) activity	GO:0004775	Molecular Function	-
Sma3	succinate-CoA ligase (GDP-forming) activity	GO:0004776	Molecular Function	-
Sma3	binding	GO:0005488	Molecular Function	-
Sma3	GTP binding	GO:0005525	Molecular Function	-
Sma3	metal ion binding	GO:0046872	Molecular Function	-
Sma3	tricarboxylic acid cycle	GO:0006099	Biological Process	-
Sma3	metabolic process	GO:0008152	Biological Process	-
Sma3	response to cadmium ion	GO:0046686	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	GPCR, rhodopsin-like, 7TM	IPR000276	-	-
Sma3	Chlorophyll A-B binding protein, plant	IPR001344	-	-
Sma3	CoA-binding	IPR003781	-	-
Sma3	Succinyl-CoA ligase, alpha subunit	IPR005810	-	-
Sma3	ATP-citrate lyase/succinyl-CoA ligase	IPR005811	-	-
Sma3	NAD(P)-binding domain	IPR016040	-	-
Sma3	Succinyl-CoA synthetase-like	IPR016102	-	-
Sma3	ATP-citrate lyase/succinyl-CoA ligase, active site	IPR017440	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT5G08300.1	Succinyl-CoA ligase, alpha subunit chr5:2667579-2669672 FORWARD LENGTH=347	8.0e-31	75%
RefSeq	Arabidopsis thaliana	NP_196447.1	Succinyl-CoA ligase [GDP-forming] subunit alpha-1 [Arabidopsis thaliana]	1.0e-30	75%
RefSeq	Populus trichocarpa	XP_002336874.1	predicted protein, partial [Populus trichocarpa]	5.0e-33	77%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: sp_plants

Fln subject: Q6ZL94

Fln msg: Distance to subject end: 165 aas, your sequence is shorter than subject: 87 - 331

Fln protein: QTHLNLPIFNSVKEAKAATKCEASVIYVPPPFAGAAIHEAIDAEIELVVCITEGIPQRDMVKVKKRLLGQTKTRLIGPNCPGIIKPG

Protein Length: 88

Fln nts: ACAAACTCACTTAAACCTTCCAATTTTCAACTCTGTTAAGGAGGCCAAAGCCGCCACTAAATGCGAGGCGTCTGTTATCTACGTTCCTCCTCCTTTTGCTGGTGCCGCTATTCACGAAGCCATTGACGCTGAAATTGAACTCGTTGTTTGCATCACCGAAGGAATTCCTCAGAGAGACATGGTAAAGGTGAAAAAGCGCCTTCTCGGACAAACAAAGACACGTTTAATCGGACCCAACTGCCCAGGAATCATTAAGCCAGGAG

Fln Alignment:

HLKU4M004H8CLM___HLNLPIFNSVKEAKAATKCEASVIYVPPPFXXXXXXXXXXXXXXLVVCITEGIPQRDMVKVKKRLLGQTKTRLIGPNCPGIIKPG
Q6ZL94________________HLGLPVFNSVAEAKAETKANASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVKVKAALNKQSKTRLIGPNCPGIIKPG

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain