|
||||||
|
UniGene Name: sp_v3.0_unigene158432
Length: 186 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene158432
T |
|
Ace file of the UniGene sp_v3.0_unigene158432
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | ABC transporter, ATP-binding/permease protein n=3 Tax=Rhodobacteraceae RepID=A9F879_9RHOB | - | - | 8.0e-20 | 78% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 52% |
| Sma3 | ABC transporter-like protein | - | - | 1.16e-09 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT4g28630; ATM2; ATM3; At4g28620; At4g28630; At5g58270; CDS1; CHLREDRAFT_105113; CHLREDRAFT_133289; CHLREDRAFT_99736; Cds1; GSVIVT00023911001; MICPUCDRAFT_45420; Os06g0128300; OsI_21465; OsJ_19973; P0538C01.5; PHATRDRAFT_11674; PHATRDRAFT_38642; PHYPADRAF |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity, coupled to transmembrane movement of substances | GO:0042626 | Molecular Function | 0.0 | - |
| Sma3 | sequence-specific DNA binding | GO:0043565 | Molecular Function | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | ABC transporter, transmembrane domain | IPR001140 | - | 0.0 | - |
| Sma3 | DNA methylase, N-6 adenine-specific, conserved site | IPR002052 | - | 0.0 | - |
| Sma3 | Transcription factor, MADS-box | IPR002100 | - | 0.0 | - |
| Sma3 | Carbohydrate/puine kinase, PfkB, conserved site | IPR002173 | - | 0.0 | - |
| Sma3 | ABC transporter-like | IPR003439 | - | 0.0 | - |
| Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
| Sma3 | ABC transporter, conserved site | IPR017871 | - | 0.0 | - |
| Sma3 | ABC transporter, integral membrane type 1 | IPR017940 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G28630.1 | ATM1, ATATM1 ABC transporter of the mitochondrion 1 chr4:14138535-14140895 REVERSE LENGTH=678 | 9.0e-19 | 63% |
| RefSeq | Arabidopsis thaliana | NP_567813.1 | ABC transporter B family member 23 [Arabidopsis thaliana] | 1.0e-18 | 63% |
| RefSeq | Populus trichocarpa | XP_002319987.1 | ABC transporter family of the mitochondria family [Populus trichocarpa] | 2.0e-19 | 69% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NW03
Fln msg: Distance to subject end: 58 aas, your sequence is shorter than subject: 61 - 636
Fln protein:
Q
Protein Length:
62
Fln nts:
T
Fln Alignment:
HLKU4M004JEBRU___DIRDITQKSLRQAIGVVPQDTVLFNDTIRYNILYGRLDATDEEIEHAAKQAQIHDFIVR
A9NW03________________DICSIRKDSLRKAVAVVPQDTVLFNDTIFHNILYGLPTASEADVTRAARQAHLHEAVLQ
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
