UniGene Name: sp_v3.0_unigene158376
Length: 232 nt
UniGene Fasta |
---|
>sp_v3.0_unigene158376
T |
Ace file of the UniGene sp_v3.0_unigene158376 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | ribosomal protein L2 [Brassica juncea] | - | - | 7.0e-27 | 68% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 63% |
Sma3 | 60S ribosomal protein L8 | - | - | 2.478e-08 | - |
Source | Gene names |
---|---|
Sma3 | At3g51190; At4g36130; CHLREDRAFT_172406; EMB2296; F23E13.20; F24M12.230; GSVIVT00026101001; GSVIVT00027466001; GSVIVT00036802001; LOC_Os12g38000; MICPUCDRAFT_49650; MICPUN_95460; MtrDRAFT_AC159144g11v2; OSTLU_31116; Os12g0567700; OsI_38771; OsJ_36548; PHA |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | ribosome | GO:0005840 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | small ribosomal subunit | GO:0015935 | Cellular Component | 0.0 | - |
Sma3 | cytosolic large ribosomal subunit | GO:0022625 | Cellular Component | 0.0 | - |
Sma3 | structural constituent of ribosome | GO:0003735 | Molecular Function | 0.0 | - |
Sma3 | translation | GO:0006412 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ribosomal protein L2 | IPR002171 | - | 0.0 | - |
Sma3 | Ribosomal protein S19/S15 | IPR002222 | - | 0.0 | - |
Sma3 | Ribosomal protein S19A/S15e | IPR005713 | - | 0.0 | - |
Sma3 | Nucleic acid-binding, OB-fold | IPR012340 | - | 0.0 | - |
Sma3 | Translation protein SH3-like, subgroup | IPR014722 | - | 0.0 | - |
Sma3 | RNA polymerase Rpb2, OB-fold | IPR014724 | - | 0.0 | - |
Sma3 | Ribosomal protein L2, domain 3 | IPR014726 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G51190.1 | Ribosomal protein L2 family chr3:19016606-19017547 REVERSE LENGTH=260 | 8.0e-35 | 68% |
RefSeq | Arabidopsis thaliana | NP_190687.2 | 60S ribosomal protein L8-2 [Arabidopsis thaliana] | 1.0e-34 | 68% |
RefSeq | Populus trichocarpa | XP_002327761.1 | predicted protein [Populus trichocarpa] | 7.0e-35 | 67% |
Full-Lengther Next Prediction |
---|
Fln status: Putative N-terminus
Fln database: coniferopsida.fasta
Fln subject: C0PQ62
Fln msg: Distance to subject end: 168 aas, atg_distance in limit (1-15): atg_distance = 15, W2: There is no M at the beginning, your sequence is shorter than subject: 77 - 259
Fln protein:
V
Protein Length:
78
Fln nts:
T
Fln Alignment:
HLKU4M004J0LH2___VFTAHVTTRKGAAKLRAIDYGEKNGYLRGLVKEIIHDPGRGAPLARVQFKHVYRYKNVNELFIASEGMYTGQFIYCG
C0PQ62________________VFTSHTHHRKGPARFRSLDYGERNGYIRGIVTDVIHDPGRGAPLCKVTFRHAFRYRHQKELFVAAEGMYTGQFVYCG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain