|
||||||
|
UniGene Name: sp_v3.0_unigene158316
Length: 117 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene158316
G |
|
Ace file of the UniGene sp_v3.0_unigene158316
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | eIF5A n=2 Tax=Percomorpha RepID=C5HBN1_PAROL | - | - | 7.0e-13 | 84% |
| FL-Next | tr=Eukaryotic translation initiation factor 5A; Picea abies (Norway spruce) (Picea excelsa). | - | - | 0.0 | 76% |
| Sma3 | Eukaryotic translation initiation factor 5A | - | - | 1.956e-28 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g13950; At1g26630; At1g69410; CHLREDRAFT_126557; EIF-5A1; EIF-5A2; EIF5A; EIF5A1; EIF5A2; EIF5A3; EIF5A4; EIF5A5; EIFSV1; F10D13.8; F16A14.17; F23O10.2; F7A19.4; GSVIVT00004748001; GSVIVT00016285001; GSVIVT00032771001; LOC_Os03g55150; LOC_Os12g32240; M |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | translation initiation factor activity | GO:0003743 | Molecular Function | 0.0 | - |
| Sma3 | translation elongation factor activity | GO:0003746 | Molecular Function | 0.0 | - |
| Sma3 | translational initiation | GO:0006413 | Biological Process | 0.0 | - |
| Sma3 | response to wounding | GO:0009611 | Biological Process | 0.0 | - |
| Sma3 | xylem development | GO:0010089 | Biological Process | 0.0 | - |
| Sma3 | host programmed cell death induced by symbiont | GO:0034050 | Biological Process | 0.0 | - |
| Sma3 | defense response to bacterium | GO:0042742 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | WD40 repeat | IPR001680 | - | 0.0 | - |
| Sma3 | Translation elongation factor IF5A | IPR001884 | - | 0.0 | - |
| Sma3 | KOW | IPR005824 | - | 0.0 | - |
| Sma3 | Nucleic acid-binding, OB-fold | IPR012340 | - | 0.0 | - |
| Sma3 | Translation protein SH3-like, subgroup | IPR014722 | - | 0.0 | - |
| Sma3 | WD40/YVTN repeat-like-containing domain | IPR015943 | - | 0.0 | - |
| Sma3 | WD40-repeat-containing domain | IPR017986 | - | 0.0 | - |
| Sma3 | Translation elongation factor, IF5A, hypusine site | IPR019769 | - | 0.0 | - |
| Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
| Sma3 | IPR019782 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G13950.1 | EIF-5A, ELF5A-1, ATELF5A-1, EIF5A eukaryotic elongation factor 5A-1 chr1:4773631-4774668 FORWARD LENGTH=158 | 3.0e-16 | 74% |
| RefSeq | Arabidopsis thaliana | NP_172848.1 | translation initiation factor eIF-5A [Arabidopsis thaliana] | 4.0e-16 | 74% |
| RefSeq | Populus trichocarpa | XP_002325136.1 | predicted protein [Populus trichocarpa] | 4.0e-17 | 76% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q3ZDK6
Fln msg: Distance to subject end: 90 aas, your sequence is shorter than subject: 39 - 159
Fln protein:
G
Protein Length:
40
Fln nts:
G
Fln Alignment:
HLKU4M004IVXGG___GFVVIKDRPCKVVDTSTSKTGKHGHAKVHMVGIDIFTGR
Q3ZDK6________________GYIVIKARPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
