|
||||||
|
UniGene Name: sp_v3.0_unigene158234
Length: 209 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene158234
T |
|
Ace file of the UniGene sp_v3.0_unigene158234
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Pyruvate dehydrogenase (Acetyl-transferring) E1 component, alpha subunit n=1 Tax=Hirschia baltica ATCC 49814 RepID=C6XJT1_HIRBI | - | - | 2.0e-24 | 73% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 64% |
| Sma3 | PDHE1-A | - | - | 3.203e-16 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Pyruvate dehydrogenase (acetyl-transferring). | EC:1.2.4.1 | - | 4.409e-27 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycolysis / Gluconeogenesis | 00010 | 4.409e-27 | % | |
| Sma3 | Citrate cycle (TCA cycle) | 00020 | 4.409e-27 | % | |
| Sma3 | Valine, leucine and isoleucine biosynthesis | 00290 | 4.409e-27 | % | |
| Sma3 | Pyruvate metabolism | 00620 | 4.409e-27 | % | |
| Sma3 | Butanoate metabolism | 00650 | 4.409e-27 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 4.409e-27 | % | |
| Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 4.409e-27 | % | |
| Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 4.409e-27 | % | |
| Sma3 | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 4.409e-27 | % | |
| Sma3 | Biosynthesis of alkaloids derived from histidine and purine | 01065 | 4.409e-27 | % | |
| Sma3 | Biosynthesis of alkaloids derived from terpenoid and polyketide | 01066 | 4.409e-27 | % | |
| Sma3 | Biosynthesis of plant hormones | 01070 | 4.409e-27 | % | |
| Sma3 | Metabolic pathways | 01100 | 4.409e-27 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 4.409e-27 | % |
| Source | Gene names |
|---|---|
| Sma3 | At1g24180; At1g59900; E1aPDH; F23H11.21; F3I6.11; GSVIVT00025274001; GSVIVT00028924001; IAR4; MICPUCDRAFT_22101; MICPUN_89160; OJ1136_C11.8; OSTLU_29179; Os02g0739600; Os06g0246500; OsI_22361; OsJ_08320; OsJ_20802; Ot01g05450; P0684F11.25; PDH E1a; PDH E1 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrial matrix | GO:0005759 | Cellular Component | 0.0 | - |
| Sma3 | intracellular membrane-bounded organelle | GO:0043231 | Cellular Component | 0.0 | - |
| Sma3 | pyruvate dehydrogenase (acetyl-transferring) activity | GO:0004739 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor | GO:0016624 | Molecular Function | 0.0 | - |
| Sma3 | glycolysis | GO:0006096 | Biological Process | 0.0 | - |
| Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
| Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Dehydrogenase, E1 component | IPR001017 | - | 0.0 | - |
| Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
| Sma3 | Pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha subunit, subgroup y | IPR017597 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G24180.1 | IAR4 Thiamin diphosphate-binding fold (THDP-binding) superfamily protein chr1:8560777-8563382 REVERSE LENGTH=393 | 1.0e-26 | 66% |
| RefSeq | Arabidopsis thaliana | NP_173828.1 | pyruvate dehydrogenase E1 component subunit alpha-2 [Arabidopsis thaliana] | 1.0e-26 | 66% |
| RefSeq | Populus trichocarpa | XP_002311788.1 | predicted protein [Populus trichocarpa] | 8.0e-26 | 64% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NWY7
Fln msg: Distance to subject end: 169 aas, your sequence is shorter than subject: 69 - 400
Fln protein:
H
Protein Length:
70
Fln nts:
T
Fln Alignment:
HLKU4M004I2FEP___HFYKADANFFGGNGIVGAQVPVGTGLALANQYLKNGRVSVSYYGDGAANQGQVFEAFNMAALWKLPAI
A9NWY7________________HFYKKENGFYGGHGIVGAQVPLGCGLAFAQKYSKAEAVTFALYGDGAANQGQLFEALNMSALWNLPAV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
