UniGene Name: sp_v3.0_unigene158183
Length: 195 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene158183
A |
Ace file of the UniGene sp_v3.0_unigene158183
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | guanine nucleotide-binding protein alpha subunit [Calliphora vicina] | - | - | 4.0e-15 | 68% |
| FL-Next | sp=Guanine nucleotide-binding protein alpha-1 subunit; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 66% |
| Sma3 | Guanine nucleotide-binding protein alpha-1 subunit | - | - | 1.167e-25 | - |
| Source | Gene names |
|---|---|
| Sma3 | Af12-aa; At2g26300; D1; GA1; GA2; GPA1; GPA2; GSVIVT00032290001; Gpa1; HG1; HG2; NtGA1; NtGA1s; NtGA2; NtGA2t; OsI_018808; OsJ_18121; PHATR_36721; POPTRDRAFT_736941; POPTRDRAFT_763163; PlGPA1; PlGPA2; RCOM_0707670; RGA1; SOGA1; T1D16.6; THAPSDRAFT_264137; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | endoplasmic reticulum membrane | GO:0005789 | Cellular Component | 0.0 | - |
| Sma3 | heterotrimeric G-protein complex | GO:0005834 | Cellular Component | 0.0 | - |
| Sma3 | GTPase activity | GO:0003924 | Molecular Function | 0.0 | - |
| Sma3 | signal transducer activity | GO:0004871 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | GTP binding | GO:0005525 | Molecular Function | 0.0 | - |
| Sma3 | channel regulator activity | GO:0016247 | Molecular Function | 0.0 | - |
| Sma3 | guanyl nucleotide binding | GO:0019001 | Molecular Function | 0.0 | - |
| Sma3 | G-protein signaling, coupled to S1P second messenger (sphingosine kinase activating) | GO:0001789 | Biological Process | 0.0 | - |
| Sma3 | protein ADP-ribosylation | GO:0006471 | Biological Process | 0.0 | - |
| Sma3 | oxygen and reactive oxygen species metabolic process | GO:0006800 | Biological Process | 0.0 | - |
| Sma3 | G-protein coupled receptor signaling pathway | GO:0007186 | Biological Process | 0.0 | - |
| Sma3 | cell death | GO:0008219 | Biological Process | 0.0 | - |
| Sma3 | gibberellic acid mediated signaling pathway | GO:0009740 | Biological Process | 0.0 | - |
| Sma3 | response to glucose stimulus | GO:0009749 | Biological Process | 0.0 | - |
| Sma3 | positive regulation of abscisic acid mediated signaling pathway | GO:0009789 | Biological Process | 0.0 | - |
| Sma3 | seed germination | GO:0009845 | Biological Process | 0.0 | - |
| Sma3 | regulation of stomatal movement | GO:0010119 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Guanine nucleotide binding protein (G-protein), alpha subunit | IPR001019 | - | 0.0 | - |
| Sma3 | Fungal G-protein, alpha subunit | IPR002975 | - | 0.0 | - |
| Sma3 | Plant G-protein, alpha subunit | IPR002976 | - | 0.0 | - |
| Sma3 | G protein alpha subunit, helical insertion | IPR011025 | - | 0.0 | - |
| Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G26300.1 | GPA1, GP ALPHA 1, ATGPA1 G protein alpha subunit 1 chr2:11198087-11200822 FORWARD LENGTH=383 | 2.0e-18 | 66% |
| RefSeq | Arabidopsis thaliana | NP_180198.1 | guanine nucleotide-binding protein alpha-1 subunit [Arabidopsis thaliana] | 2.0e-18 | 66% |
| RefSeq | Populus trichocarpa | XP_002308517.1 | predicted protein [Populus trichocarpa] | 2.0e-18 | 66% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: P18064
Fln msg: Distance to subject end: 116 aas, your sequence is shorter than subject: 64 - 383
Fln protein:
L
Protein Length:
65
Fln nts:
A
Fln Alignment:
HLKU4M004IGFS2___GIICRMVDVGGQRSERRKWIHFFEGVTAVIFFASLSEYDQTLQEAKTVNRMHESLTL
P18064________________GEVYRLFDVGGQRNERRKWIHLFEGVTAVIFCAAISEYDQTLFEDEQKNRMMETKEL

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta