UniGene Name: sp_v3.0_unigene158023
Length: 171 nt
UniGene Fasta |
---|
>sp_v3.0_unigene158023
A |
Ace file of the UniGene sp_v3.0_unigene158023 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Succinyl-CoA ligase [ADP-forming] subunit beta n=4 Tax=Gammaproteobacteria RepID=SUCC_AERHH | - | - | 2.0e-20 | 78% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 78% |
Sma3 | Succinyl-CoA synthetase beta chain | - | - | 8.801e-09 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Succinate--CoA ligase (GDP-forming). | EC:6.2.1.4 | - | 1.921e-21 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Citrate cycle (TCA cycle) | 00020 | 1.921e-21 | % | |
Sma3 | Propanoate metabolism | 00640 | 1.921e-21 | % | |
Sma3 | Biosynthesis of phenylpropanoids | 01061 | 1.921e-21 | % | |
Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 1.921e-21 | % | |
Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 1.921e-21 | % | |
Sma3 | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 1.921e-21 | % | |
Sma3 | Biosynthesis of alkaloids derived from histidine and purine | 01065 | 1.921e-21 | % | |
Sma3 | Biosynthesis of alkaloids derived from terpenoid and polyketide | 01066 | 1.921e-21 | % | |
Sma3 | Biosynthesis of plant hormones | 01070 | 1.921e-21 | % | |
Sma3 | Metabolic pathways | 01100 | 1.921e-21 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.921e-21 | % | |
Sma3 | Succinate--CoA ligase (ADP-forming). | EC:6.2.1.5 | - | 1.848e-07 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Citrate cycle (TCA cycle) | 00020 | 1.848e-07 | % | |
Sma3 | Propanoate metabolism | 00640 | 1.848e-07 | % | |
Sma3 | C5-Branched dibasic acid metabolism | 00660 | 1.848e-07 | % | |
Sma3 | Carbon fixation pathways in prokaryotes | 00720 | 1.848e-07 | % | |
Sma3 | Biosynthesis of phenylpropanoids | 01061 | 1.848e-07 | % | |
Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 1.848e-07 | % | |
Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 1.848e-07 | % | |
Sma3 | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 1.848e-07 | % | |
Sma3 | Biosynthesis of alkaloids derived from histidine and purine | 01065 | 1.848e-07 | % | |
Sma3 | Biosynthesis of alkaloids derived from terpenoid and polyketide | 01066 | 1.848e-07 | % | |
Sma3 | Biosynthesis of plant hormones | 01070 | 1.848e-07 | % | |
Sma3 | Metabolic pathways | 01100 | 1.848e-07 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.848e-07 | % |
Source | Gene names |
---|---|
Sma3 | At2g20420; CHLREDRAFT_24101; F11A3.3; GSVIVT00028552001; MICPUCDRAFT_34011; MICPUN_104715; OSTLU_31367; Os02g0621700; OsI_08117; OsJ_07569; Ot04g04570; PHATRDRAFT_26921; POPTRDRAFT_553334; POPTRDRAFT_730613; RCOM_0258610; SCLB1a|SCLB1b; SCS-beta; SCS1; SC |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
Sma3 | succinate-CoA ligase (ADP-forming) activity | GO:0004775 | Molecular Function | 0.0 | - |
Sma3 | succinate-CoA ligase (GDP-forming) activity | GO:0004776 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | ligase activity | GO:0016874 | Molecular Function | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Succinyl-CoA synthetase, beta subunit | IPR005809 | - | 0.0 | - |
Sma3 | ATP-citrate lyase/succinyl-CoA ligase | IPR005811 | - | 0.0 | - |
Sma3 | ATP-grasp fold | IPR011761 | - | 0.0 | - |
Sma3 | ATP-grasp fold, succinyl-CoA synthetase-type | IPR013650 | - | 0.0 | - |
Sma3 | ATP-grasp fold, subdomain 2 | IPR013816 | - | 0.0 | - |
Sma3 | Succinyl-CoA synthetase-like | IPR016102 | - | 0.0 | - |
Sma3 | Succinyl-CoA synthetase, beta subunit, conserved site | IPR017866 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G20420.1 | ATP citrate lyase (ACL) family protein chr2:8805574-8807858 FORWARD LENGTH=421 | 3.0e-26 | 80% |
RefSeq | Arabidopsis thaliana | NP_179632.1 | Succinyl-CoA ligase [GDP-forming] subunit beta [Arabidopsis thaliana] | 3.0e-26 | 80% |
RefSeq | Populus trichocarpa | XP_002301863.1 | predicted protein [Populus trichocarpa] | 4.0e-26 | 80% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5A8F9
Fln msg: Distance to subject end: 98 aas, your sequence is shorter than subject: 56 - 425
Fln protein:
H
Protein Length:
57
Fln nts:
A
Fln Alignment:
HLKU4M004IAM5M___DPSEDDPREVAAAQYNLNYIGMEGNIGCMVNGAGLAMATMDIIQLHGGSPANFLD
D5A8F9________________DKSQEDPREVSAAEADLNYIGLDGEIGCMVNGAGLAMATMDIIKLHGGTPANFLD
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain