|
||||||
|
UniGene Name: sp_v3.0_unigene157640
Length: 220 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene157640
T |
|
Ace file of the UniGene sp_v3.0_unigene157640
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Ubiquitin-conjugating enzyme E2-17 kDa n=1 Tax=Acromyrmex echinatior RepID=F4WW03_9HYME | - | - | 1.0e-34 | 87% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 77% |
| Sma3 | Ubiquitin carrier protein | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ligases, Forming carbon-nitrogen bonds, Acid--D-amino-acid ligases (peptide synthases). | EC:6.3.2.- | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Tryptophan metabolism | 00380 | 0.0 | % | |
| Sma3 | Biosynthesis of siderophore group nonribosomal peptides | 01053 | 0.0 | % | |
| Sma3 | Ubiquitin--protein ligase. | EC:6.3.2.19 | - | 3.953e-16 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT3G13550; AT5G41700; AT5G53300; At1g36340; At1g64230; At2g16740; At3g08690; At3g08700; At3g13550; At4g27960; At5g41700; At5g53300; At5g56150; B0811B10.8; B1043F11.37; CHLREDRAFT_152525; CHLREDRAFT_160028; COP10; Elr; F17O14.16; F17O14.17; F22C12.2; F7F23 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | hydrolase activity, hydrolyzing O-glycosyl compounds | GO:0004553 | Molecular Function | 0.0 | - |
| Sma3 | ubiquitin-protein ligase activity | GO:0004842 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | small conjugating protein ligase activity | GO:0019787 | Molecular Function | 0.0 | - |
| Sma3 | cation binding | GO:0043169 | Molecular Function | 0.0 | - |
| Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
| Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
| Sma3 | red, far-red light phototransduction | GO:0009585 | Biological Process | 0.0 | - |
| Sma3 | red or far-red light signaling pathway | GO:0010017 | Biological Process | 0.0 | - |
| Sma3 | modification-dependent protein catabolic process | GO:0019941 | Biological Process | 0.0 | - |
| Sma3 | post-translational protein modification | GO:0043687 | Biological Process | 0.0 | - |
| Sma3 | regulation of protein metabolic process | GO:0051246 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycoside hydrolase, family 17 | IPR000490 | - | 0.0 | - |
| Sma3 | Ubiquitin-conjugating enzyme, E2 | IPR000608 | - | 0.0 | - |
| Sma3 | X8 | IPR012946 | - | 0.0 | - |
| Sma3 | Thioredoxin domain | IPR013766 | - | 0.0 | - |
| Sma3 | Glycoside hydrolase, subgroup, catalytic domain | IPR013781 | - | 0.0 | - |
| Sma3 | Ubiquitin-conjugating enzyme/RWD-like | IPR016135 | - | 0.0 | - |
| Sma3 | IPR017936 | - | 0.0 | - | |
| Sma3 | Thioredoxin, conserved site | IPR017937 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G08690.1 | UBC11, ATUBC11 ubiquitin-conjugating enzyme 11 chr3:2641487-2642489 FORWARD LENGTH=148 | 9.0e-39 | 69% |
| RefSeq | Arabidopsis thaliana | NP_001189841.1 | ubiquitin-conjugating enzyme E2 11 [Arabidopsis thaliana] | 1.0e-38 | 69% |
| RefSeq | Populus trichocarpa | XP_002331848.1 | predicted protein [Populus trichocarpa] | 4.0e-38 | 69% |
| Full-Lengther Next Prediction |
|---|
Fln status: Putative N-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NLA0
Fln msg: Distance to subject end: 65 aas, atg_distance in limit (1-15): atg_distance = 11, W2: There is no M at the beginning, your sequence is shorter than subject: 72 - 148
Fln protein:
Q
Protein Length:
73
Fln nts:
T
Fln Alignment:
HLKU4M004J1EQ7___QDLGRDPPSSCSAGPVGDDLYHWSATIMGPPDSPYQSGVFFLNIHFPTDYPFKPPKINFTTRIYHPNINANG
A9NLA0________________QDLQRDPPTSCSAGPVGEDLFHWQATIMGPTDSPYAGGVFFVMIHFPPDYPFKPPKVNFQTKVYHPNINSNG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
