UniGene Name: sp_v3.0_unigene157567
Length: 172 nt
![]() |
---|
>sp_v3.0_unigene157567
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Os10g0432200 protein (Fragment) n=1 Tax=Oryza sativa Japonica Group RepID=Q0IXI4_ORYSJ | - | - | 3.0e-21 | 83% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 85% |
Sma3 | Rnase l inhibitor, putative | - | - | 1.649e-08 | - |
Source | Gene names |
---|---|
Sma3 | AT4g19210; At3g13640; At4g19210; CHLREDRAFT_119356; GSVIVT00001176001; HC352; HC352a; HC352b; LOC_Os10g29650; LOC_Os11g34350; MICPUCDRAFT_68127; MICPUN_64787; OSJNBa0063E14.35; OSTLU_27256; OSTLU_29654; Os02g0282900; Os10g0432200; Os11g0546000; OsI_06764; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | ARF GTPase activator activity | GO:0008060 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
Sma3 | ATPase activity | GO:0016887 | Molecular Function | 0.0 | - |
Sma3 | iron-sulfur cluster binding | GO:0051536 | Molecular Function | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Sma3 | regulation of ARF GTPase activity | GO:0032312 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Arf GTPase activating protein | IPR001164 | - | 0.0 | - |
Sma3 | 4Fe-4S binding domain | IPR001450 | - | 0.0 | - |
Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
Sma3 | Ankyrin repeat | IPR002110 | - | 0.0 | - |
Sma3 | ABC transporter-like | IPR003439 | - | 0.0 | - |
Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
Sma3 | RNase L inhibitor RLI, possible metal-binding domain | IPR007209 | - | 0.0 | - |
Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
Sma3 | ABC transporter, ABCE | IPR013283 | - | 0.0 | - |
Sma3 | ABC transporter, conserved site | IPR017871 | - | 0.0 | - |
Sma3 | 4Fe-4S ferredoxin-type, iron-sulpur binding domain | IPR017896 | - | 0.0 | - |
Sma3 | 4Fe-4S ferredoxin, iron-sulphur binding, conserved site | IPR017900 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G19210.1 | ATRLI2, RLI2 RNAse l inhibitor protein 2 chr4:10501906-10504776 FORWARD LENGTH=605 | 8.0e-27 | 83% |
RefSeq | Arabidopsis thaliana | NP_193656.2 | ABC transporter E family member 2 [Arabidopsis thaliana] | 1.0e-26 | 83% |
RefSeq | Populus trichocarpa | XP_002303221.1 | predicted protein, partial [Populus trichocarpa] | 2.0e-27 | 87% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LR96
Fln msg: Distance to subject end: 39 aas, your sequence is shorter than subject: 57 - 605
Fln protein:
I
Protein Length:
58
Fln nts:
C
Fln Alignment:
HLKU4M004I5K6D___IKRYILHSKKTAFVVEHDFIMATYLADRVIVYEGEPSVDCKANAPESLLTGMNKFL
B8LR96________________IKRFILHAKKTAFVVEHDFIMATYLADRVIVYEGRPSVDCVANTPQSLQTGMNLFL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain