|
||||||
|
UniGene Name: sp_v3.0_unigene157555
Length: 195 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene157555
A |
|
Ace file of the UniGene sp_v3.0_unigene157555
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Cysteine desulfurase n=1 Tax=Sorangium cellulosum 'So ce 56' RepID=A9EXZ8_SORC5 | - | - | 2.0e-20 | 80% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 67% |
| Sma3 | Cysteine desulfurase | - | - | 3.69e-11 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Cysteine desulfurase. | EC:2.8.1.7 | - | 1.221e-07 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Thiamine metabolism | 00730 | 1.221e-07 | % |
| Source | Gene names |
|---|---|
| Sma3 | AT5G65720; At5g65720; CHLREDRAFT_191269; F6H11.150; GSVIVT00011471001; GSVIVT00017707001; IscS; MICPUCDRAFT_21333; MICPUN_108046; MPA24.7; NFS1; NIFS; NIFS1; OJ1118_A10.25; OSTLU_45194; Os09g0338400; OsJ_28956; Ot03g02290; PHATRDRAFT_34119; PHYPADRAFT_123 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | pyridoxal phosphate binding | GO:0030170 | Molecular Function | 0.0 | - |
| Sma3 | cysteine desulfurase activity | GO:0031071 | Molecular Function | 0.0 | - |
| Sma3 | cysteine metabolic process | GO:0006534 | Biological Process | 0.0 | - |
| Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
| Sma3 | iron-sulfur cluster assembly | GO:0016226 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Aminotransferase, class V/Cysteine desulfurase | IPR000192 | - | 0.0 | - |
| Sma3 | Cysteine desulfurase | IPR010240 | - | 0.0 | - |
| Sma3 | Pyridoxal phosphate-dependent transferase, major region, subdomain 1 | IPR015421 | - | 0.0 | - |
| Sma3 | Pyridoxal phosphate-dependent transferase, major region, subdomain 2 | IPR015422 | - | 0.0 | - |
| Sma3 | Cysteine desulfurase, NifS | IPR016454 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G65720.1 | ATNIFS1, NIFS1, NFS1, ATNFS1 nitrogen fixation S (NIFS)-like 1 chr5:26296349-26297710 FORWARD LENGTH=453 | 2.0e-21 | 65% |
| RefSeq | Arabidopsis thaliana | NP_001078802.1 | cysteine desulfurase 1 [Arabidopsis thaliana] | 7.0e-22 | 65% |
| RefSeq | Populus trichocarpa | XP_002310363.1 | predicted protein [Populus trichocarpa] | 4.0e-23 | 70% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AA74
Fln msg: Distance to subject end: 26 aas, your sequence is shorter than subject: 64 - 455
Fln protein:
W
Protein Length:
65
Fln nts:
A
Fln Alignment:
HLKU4M004IU0LD___IRDVAVSSGSACTSASLEPSYVLRAIGVGDDLAHSSIRFGLGRFNTEAEVDHVAKQVVQAV
D5AA74________________LKEVAVSSGSACTSASLEPSYVLRALGVEEDMAHTSIRFGIGRFTTPQEIDRTIKLTVDQV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
