UniGene Name: sp_v3.0_unigene157482
Length: 177 nt
![]() |
---|
>sp_v3.0_unigene157482
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Cysteine synthase n=1 Tax=Waddlia chondrophila WSU 86-1044 RepID=D6YWJ0_WADCW | - | - | 2.0e-14 | 65% |
FL-Next | sp=Cysteine synthase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 59% |
Sma3 | Cysteine synthase | - | - | 1.087e-33 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Cysteine synthase. | EC:2.5.1.47 | - | 7.029e-28 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Cysteine and methionine metabolism | 00270 | 7.029e-28 | % | |
Sma3 | Sulfur metabolism | 00920 | 7.029e-28 | % | |
Sma3 | Metabolic pathways | 01100 | 7.029e-28 | % | |
Sma3 | Transferred entry: 2.5.1.47. | EC:4.2.99.8 | - | 2.043e-07 | - |
Source | Gene names |
---|---|
Sma3 | At2g43750; CHLREDRAFT_175651; CSase B; CYSK; F18O19.14; GSVIVT00034691001; OASB; OASTL; OASTL1; Os06g0149700; Os06g0564500; OsI_21686; OsI_23398; OsJ_20137; OsJ_21722; P0656E03.40; P0710H01.8; PHYPADRAFT_192780; POPTRDRAFT_270612; RCOM_0723350; gcs2; gcs3 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | chromoplast | GO:0009509 | Cellular Component | 0.0 | - |
Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | cysteine synthase activity | GO:0004124 | Molecular Function | 0.0 | - |
Sma3 | transferase activity | GO:0016740 | Molecular Function | 0.0 | - |
Sma3 | lyase activity | GO:0016829 | Molecular Function | 0.0 | - |
Sma3 | pyridoxal phosphate binding | GO:0030170 | Molecular Function | 0.0 | - |
Sma3 | cysteine biosynthetic process from serine | GO:0006535 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Cysteine synthase/cystathionine beta-synthase P-phosphate-binding site | IPR001216 | - | 0.0 | - |
Sma3 | Pyridoxal phosphate-dependent enzyme, beta subunit | IPR001926 | - | 0.0 | - |
Sma3 | Cysteine synthase K/M | IPR005856 | - | 0.0 | - |
Sma3 | Cysteine synthase A | IPR005859 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G43750.1 | OASB, ACS1, CPACS1, ATCS-B O-acetylserine (thiol) lyase B chr2:18129604-18132322 REVERSE LENGTH=392 | 7.0e-13 | 60% |
RefSeq | Arabidopsis thaliana | NP_001189745.1 | cysteine synthase [Arabidopsis thaliana] | 1.0e-12 | 60% |
RefSeq | Populus trichocarpa | XP_002330649.1 | predicted protein, partial [Populus trichocarpa] | 3.0e-13 | 62% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NS10
Fln msg: Distance to subject end: 128 aas, your sequence is shorter than subject: 58 - 401
Fln protein:
K
Protein Length:
59
Fln nts:
C
Fln Alignment:
HLKU4M004JC527___ETPNSFRIDQYDNKLNPEAHYLSTGPEIWEQMNGKIDYFVAXXXXXXXXXXXXRYLK
A9NS10________________KTPNAYMLQQFDNPANPKVHYETTGPEIWEDTEGKVDIFVAGIGTGGTVTGVGRYLK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain