UniGene Name: sp_v3.0_unigene157375
Length: 105 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene157375
T |
Ace file of the UniGene sp_v3.0_unigene157375 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Aldehyde dehydrogenase n=1 Tax=Volvox carteri f. nagariensis RepID=D8UHH5_VOLCA | - | - | 1.0e-11 | 91% |
| FL-Next | sp=Delta-1-pyrroline-5-carboxylate dehydrogenase 12A1, mitochondrial; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 85% |
| Sma3 | Aldehyde dehydrogenase | - | - | 4.081e-09 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Aldehyde dehydrogenase (NAD(+)). | EC:1.2.1.3 | - | 1.084e-09 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycolysis / Gluconeogenesis | 00010 | 1.084e-09 | % | |
| Sma3 | Pentose and glucuronate interconversions | 00040 | 1.084e-09 | % | |
| Sma3 | Ascorbate and aldarate metabolism | 00053 | 1.084e-09 | % | |
| Sma3 | Fatty acid metabolism | 00071 | 1.084e-09 | % | |
| Sma3 | Valine, leucine and isoleucine degradation | 00280 | 1.084e-09 | % | |
| Sma3 | Lysine degradation | 00310 | 1.084e-09 | % | |
| Sma3 | Arginine and proline metabolism | 00330 | 1.084e-09 | % | |
| Sma3 | Histidine metabolism | 00340 | 1.084e-09 | % | |
| Sma3 | Tryptophan metabolism | 00380 | 1.084e-09 | % | |
| Sma3 | beta-Alanine metabolism | 00410 | 1.084e-09 | % | |
| Sma3 | Glycerolipid metabolism | 00561 | 1.084e-09 | % | |
| Sma3 | Pyruvate metabolism | 00620 | 1.084e-09 | % | |
| Sma3 | Chloroalkane and chloroalkene degradation | 00625 | 1.084e-09 | % | |
| Sma3 | Propanoate metabolism | 00640 | 1.084e-09 | % | |
| Sma3 | Limonene and pinene degradation | 00903 | 1.084e-09 | % | |
| Sma3 | Metabolic pathways | 01100 | 1.084e-09 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.084e-09 | % |
| Source | Gene names |
|---|---|
| Sma3 | ALD1; ALD2; ALDH12A; ALDH12A1; At5g62530; CHLREDRAFT_150809; FIS1; GSVIVT00000104001; K19B1.14; OJ1741_B01.10; OsI_20777; OsJ_19352; Ot03g05840; P5CDH; P5CDH1; PHATRDRAFT_31906; PHYPADRAFT_207743; POPTRDRAFT_581353; RCOM_1513940; THAPS_38066; VITISV_03457 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrial matrix | GO:0005759 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | 1-pyrroline-5-carboxylate dehydrogenase activity | GO:0003842 | Molecular Function | 0.0 | - |
| Sma3 | aldehyde dehydrogenase (NAD) activity | GO:0004029 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
| Sma3 | oxygen and reactive oxygen species metabolic process | GO:0006800 | Biological Process | 0.0 | - |
| Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
| Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
| Sma3 | proline catabolic process to glutamate | GO:0010133 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Carbamoyl-phosphate synthetase, large subunit, ATP-binding | IPR005479 | - | 0.0 | - |
| Sma3 | Aldehyde dehydrogenase domain | IPR015590 | - | 0.0 | - |
| Sma3 | Aldehyde dehydrogenase, conserved site | IPR016160 | - | 0.0 | - |
| Sma3 | Aldehyde dehydrogenase, N-terminal | IPR016162 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G62530.1 | ALDH12A1, ATP5CDH, P5CDH aldehyde dehydrogenase 12A1 chr5:25099768-25103159 REVERSE LENGTH=556 | 6.0e-16 | 85% |
| RefSeq | Arabidopsis thaliana | NP_568955.1 | delta-1-pyrroline-5-carboxylate dehydrogenase 12A1 [Arabidopsis thaliana] | 8.0e-16 | 85% |
| RefSeq | Populus trichocarpa | XP_002330119.1 | predicted protein [Populus trichocarpa] | 8.0e-16 | 85% |
Full-Lengther Next Prediction |
|---|
Fln status: Putative C-terminus
Fln database: sp_plants
Fln subject: Q8VZC3
Fln msg: STOP codon was not found. Distance to subject end: 9 aas, your sequence is shorter than subject: 34 - 556
Fln protein:
G
Protein Length:
35
Fln nts:
T
Fln Alignment:
HLKU4M004JXJ9F___GPAGDPRGAGIGTPEAILLVWSCHREIVSDFGPV
Q8VZC3________________GPAGDPRGAGIGTPEAIKLVWSCHREVIYDYGPV

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)