UniGene Name: sp_v3.0_unigene157262
Length: 223 nt
UniGene Fasta |
---|
>sp_v3.0_unigene157262
C |
Ace file of the UniGene sp_v3.0_unigene157262 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Chaperone protein DnaK n=1 Tax=Terriglobus saanensis SP1PR4 RepID=E8V5X3_TERSS | - | - | 2.0e-28 | 85% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 59% |
Sma3 | Heat shock 70 kDa protein | - | - | 1.937e-28 | - |
Source | Gene names |
---|---|
Sma3 | AT4g24280; AT4g37910; At4g24280; At4g37910; At5g09590; At5g49910; CHLREDRAFT_126835; CHLREDRAFT_137452; F17I14_220; F20D10.30; GSVIVT00004141001; GSVIVT00005738001; GSVIVT00012517001; GSVIVT00017724001; Grc000102; HSP1; HSP68; HSP70; HSP70B; HSP70C; HSP70 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
Sma3 | thylakoid | GO:0009579 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | unfolded protein binding | GO:0051082 | Molecular Function | 0.0 | - |
Sma3 | protein folding | GO:0006457 | Biological Process | 0.0 | - |
Sma3 | response to stress | GO:0006950 | Biological Process | 0.0 | - |
Sma3 | response to heat | GO:0009408 | Biological Process | 0.0 | - |
Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
Sma3 | response to virus | GO:0009615 | Biological Process | 0.0 | - |
Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Heat shock protein Hsp70 | IPR001023 | - | 0.0 | - |
Sma3 | Chaperone DnaK | IPR012725 | - | 0.0 | - |
Sma3 | Heat shock protein 70 | IPR013126 | - | 0.0 | - |
Sma3 | Heat shock protein 70, conserved site | IPR018181 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G37910.1 | mtHsc70-1 mitochondrial heat shock protein 70-1 chr4:17825368-17828099 REVERSE LENGTH=682 | 3.0e-19 | 59% |
RefSeq | Arabidopsis thaliana | NP_195504.2 | molecular chaperone DnaK [Arabidopsis thaliana] | 4.0e-19 | 59% |
RefSeq | Populus trichocarpa | XP_002300311.1 | predicted protein [Populus trichocarpa] | 1.0e-19 | 61% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LM05
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 321 aas, your sequence is shorter than subject: 67 - 708
Fln protein:
L
Protein Length:
68
Fln nts:
C
Fln Alignment:
HLKU4M004JE0KD___LRDKGNEMALQRLKDAAERAKIELSTAIETEINLPFVTADATGPKHLVEKLTRAKLESLVDDLL*R
B8LM05________________LKDK---QALQRLTETAEKAKIELSSLTQTSISLPFVTATADGPKHIETTLTRVKFEELCSDLLDR
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain