UniGene Name: sp_v3.0_unigene157163
Length: 188 nt
![]() |
---|
>sp_v3.0_unigene157163
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | DnaJ-like subfamily B member 6 n=2 Tax=Percomorpha RepID=Q3HS39_PAROL | - | - | 2.0e-17 | 71% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 62% |
Sma3 | Protein SIS1, putative | - | - | 5.202e-11 | - |
Source | Gene names |
---|---|
Sma3 | AT4g28480; At1g10350; At2g20560; At3g08910; At3g62600; At4g28480; At5g01390; At5g01390/T10O8_100; At5g25530; CHLREDRAFT_134606; CHLREDRAFT_195902; CHLREDRAFT_96566; DNJ3; DNJ35; ERJ1; F20O9.160; F23H11.4; F26K9_30; GSVIVT00000072001; GSVIVT00003050001; GS |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | endoplasmic reticulum lumen | GO:0005788 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | heat shock protein binding | GO:0031072 | Molecular Function | 0.0 | - |
Sma3 | unfolded protein binding | GO:0051082 | Molecular Function | 0.0 | - |
Sma3 | protein folding | GO:0006457 | Biological Process | 0.0 | - |
Sma3 | response to stress | GO:0006950 | Biological Process | 0.0 | - |
Sma3 | cell redox homeostasis | GO:0045454 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Heat shock protein DnaJ, cysteine-rich domain | IPR001305 | - | 0.0 | - |
Sma3 | Chlorophyll A-B binding protein, plant | IPR001344 | - | 0.0 | - |
Sma3 | Tetratricopeptide TPR-1 | IPR001440 | - | 0.0 | - |
Sma3 | Heat shock protein DnaJ, N-terminal | IPR001623 | - | 0.0 | - |
Sma3 | Chaperone DnaJ, C-terminal | IPR002939 | - | 0.0 | - |
Sma3 | Heat shock protein DnaJ | IPR003095 | - | 0.0 | - |
Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
Sma3 | IPR012335 | - | 0.0 | - | |
Sma3 | Chaperone DnaJ | IPR012724 | - | 0.0 | - |
Sma3 | Tetratricopeptide repeat-containing domain | IPR013026 | - | 0.0 | - |
Sma3 | Tetratricopeptide TPR2 | IPR013105 | - | 0.0 | - |
Sma3 | Thioredoxin domain | IPR013766 | - | 0.0 | - |
Sma3 | IPR015609 | - | 0.0 | - | |
Sma3 | IPR017936 | - | 0.0 | - | |
Sma3 | Thioredoxin, conserved site | IPR017937 | - | 0.0 | - |
Sma3 | Heat shock protein DnaJ, conserved site | IPR018253 | - | 0.0 | - |
Sma3 | Ribosomal protein S14, conserved site | IPR018271 | - | 0.0 | - |
Sma3 | Tetratricopeptide repeat | IPR019734 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G01390.1 | DNAJ heat shock family protein chr5:160500-162199 REVERSE LENGTH=335 | 2.0e-22 | 61% |
RefSeq | Arabidopsis thaliana | NP_001154690.1 | putative DNAJ heat shock protein [Arabidopsis thaliana] | 1.0e-22 | 61% |
RefSeq | Populus trichocarpa | XP_002324266.1 | predicted protein [Populus trichocarpa] | 2.0e-22 | 65% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LLM7
Fln msg: Distance to subject end: 250 aas, your sequence is shorter than subject: 62 - 336
Fln protein:
R
Protein Length:
63
Fln nts:
T
Fln Alignment:
HLKU4M004JURPQ___RELSLKWHPDKNPDKKEEAEKKFVEIAQAYEVLSDEEKRKIYDQYGEEGLSQNAQAGNRGG
B8LLM7________________RKLAMKWHPDKNPNNKKEAEAKFKQISEAYEVLSDNQKRQIYDQYGEEGLKGQVPPPAAGG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain