UniGene Name: sp_v3.0_unigene157153
Length: 215 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene157153
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | pentatricopeptide, putative [Oryza sativa Japonica Group] | - | - | 4.0e-18 | 61% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 62% |
Sma3 | Pentatricopeptide, putative | - | - | 4.095e-08 | - |
Source | Gene names |
---|---|
Sma3 | At1g06140; At1g20230; At1g74600; At2g13600; At2g22070; At3g11460; At3g49170; At4g16835; DYW10; EMB2261; F1M20.28; F24K9.13; F2K15.30; FCAALL.441; GSVIVT00001706001; GSVIVT00006516001; GSVIVT00006973001; GSVIVT00007922001; GSVIVT00011422001; GSVIVT00013634 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | ubiquitin thiolesterase activity | GO:0004221 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | deaminase activity | GO:0019239 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Sma3 | purine ribonucleoside monophosphate biosynthetic process | GO:0009168 | Biological Process | 0.0 | - |
Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G16835.1 | Tetratricopeptide repeat (TPR)-like superfamily protein chr4:9472763-9474803 FORWARD LENGTH=656 | 4.0e-26 | 60% |
RefSeq | Arabidopsis thaliana | NP_680717.2 | tetratricopeptide repeat domain-containing protein [Arabidopsis thaliana] | 6.0e-26 | 60% |
RefSeq | Populus trichocarpa | XP_002302824.1 | predicted protein [Populus trichocarpa] | 2.0e-26 | 63% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5ADG9
Fln msg: Distance to subject end: 178 aas, your sequence is shorter than subject: 71 - 312
Fln protein:
F
Protein Length:
72
Fln nts:
A
Fln Alignment:
HLKU4M004J0QGU___FNSMIREYCITPRADHYACMVDLLARAGLLNEALDFIHKMPFKPHAAVWGSLLGSCKIHSNVDLGKYAAE
D5ADG9________________YNCMTLDYAITPTVEHYACMVDLLGRAGHLNEAWDFIEKMPIEPGASVWGAFLGSCRIHCNIELGERVAE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain