|
||||||
|
UniGene Name: sp_v3.0_unigene156989
Length: 239 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene156989
A |
|
Ace file of the UniGene sp_v3.0_unigene156989
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | dTDP-glucose 4-6-dehydratase n=1 Tax=Synechocystis sp. PCC 6803 RepID=P74036_SYNY3 | - | - | 9.0e-23 | 62% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 59% |
| Sma3 | UDP-glucuronic acid decarboxylase | - | - | 2.271e-24 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | UDP-glucuronate decarboxylase. | EC:4.1.1.35 | - | 5.927e-31 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Starch and sucrose metabolism | 00500 | 5.927e-31 | % | |
| Sma3 | Amino sugar and nucleotide sugar metabolism | 00520 | 5.927e-31 | % | |
| Sma3 | Metabolic pathways | 01100 | 5.927e-31 | % |
| Source | Gene names |
|---|---|
| Sma3 | AT2G47650; AT3G46440; At2g28760; At3g46440; At3g53520; At3g62830; At5g59290; B1012D10.32; CHLREDRAFT_135101; D18; DGD2; F18L15.160; F26K9_260; F4P12.220; F4P12_220; GAD1; GSVIVT00018513001; GSVIVT00028008001; GSVIVT00033009001; LOC_Os03g16980; OSTLU_29801 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Golgi membrane | GO:0000139 | Cellular Component | 0.0 | - |
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | Golgi apparatus | GO:0005794 | Cellular Component | 0.0 | - |
| Sma3 | cytosol | GO:0005829 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
| Sma3 | UDP-glucuronate decarboxylase activity | GO:0048040 | Molecular Function | 0.0 | - |
| Sma3 | coenzyme binding | GO:0050662 | Molecular Function | 0.0 | - |
| Sma3 | D-xylose metabolic process | GO:0042732 | Biological Process | 0.0 | - |
| Sma3 | cellular metabolic process | GO:0044237 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | NAD-dependent epimerase/dehydratase | IPR001509 | - | 0.0 | - |
| Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G47650.2 | UXS4 UDP-xylose synthase 4 chr2:19538751-19541364 REVERSE LENGTH=449 | 3.0e-26 | 56% |
| RefSeq | Arabidopsis thaliana | NP_182287.1 | UDP-xylose synthase 4 [Arabidopsis thaliana] | 4.0e-26 | 56% |
| RefSeq | Populus trichocarpa | XP_002309434.1 | predicted protein, partial [Populus trichocarpa] | 4.0e-26 | 55% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NUL8
Fln msg: Distance to subject end: 229 aas, your sequence is shorter than subject: 79 - 417
Fln protein:
M
Protein Length:
80
Fln nts:
A
Fln Alignment:
HLKU4M004JICPG___MRIIVSGGAGFIGSHLVDSLLLQGHQVFCIDNFYSSTEENVAHLLNNNNFHLIRCDVTEAPFLENIQQIYHLACPASPI
A9NUL8________________LRIVVTGGAGFVGSHLVDRLLERGDHVIVIDNFFTGRKENVMHHFKNPRFELIRHDVVE-PILLEVDQIYHLACPASPV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
