UniGene Name: sp_v3.0_unigene156972
Length: 186 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene156972
C |
Ace file of the UniGene sp_v3.0_unigene156972
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Malate dehydrogenase n=10 Tax=Pinaceae RepID=A9NVT9_PICSI | - | - | 7.0e-05 | 48% |
| FL-Next | sp=Malate dehydrogenase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 70% |
| Sma3 | Malate dehydrogenase | - | - | 1.137e-37 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Malate dehydrogenase. | EC:1.1.1.37 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Citrate cycle (TCA cycle) | 00020 | 0.0 | % | |
| Sma3 | Pyruvate metabolism | 00620 | 0.0 | % | |
| Sma3 | Glyoxylate and dicarboxylate metabolism | 00630 | 0.0 | % | |
| Sma3 | Methane metabolism | 00680 | 0.0 | % | |
| Sma3 | Carbon fixation in photosynthetic organisms | 00710 | 0.0 | % | |
| Sma3 | Carbon fixation pathways in prokaryotes | 00720 | 0.0 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 0.0 | % | |
| Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 0.0 | % | |
| Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 0.0 | % | |
| Sma3 | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 0.0 | % | |
| Sma3 | Biosynthesis of alkaloids derived from histidine and purine | 01065 | 0.0 | % | |
| Sma3 | Biosynthesis of alkaloids derived from terpenoid and polyketide | 01066 | 0.0 | % | |
| Sma3 | Biosynthesis of plant hormones | 01070 | 0.0 | % | |
| Sma3 | Metabolic pathways | 01100 | 0.0 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 0.0 | % |
| Source | Gene names |
|---|---|
| Sma3 | AT1G04410; At1g04410; At5g43330; CHLREDRAFT_158129; CMDH; F19P19.13; GSVIVT00019169001; GSVIVT00028594001; GSVIVT00028595001; IhMDH1; LOC_Os10g33800; MDH; MDH1; MDH2; MDH3; MICPUCDRAFT_49609; MICPUN_99233; MWF20.2; NAD-MDH; NR1; OSJNBa0055P24.3; Os10g0478 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | GO:0008415 | Molecular Function | 0.0 | - | |
| Sma3 | malate dehydrogenase activity | GO:0016615 | Molecular Function | 0.0 | - |
| Sma3 | L-malate dehydrogenase activity | GO:0030060 | Molecular Function | 0.0 | - |
| Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
| Sma3 | glycolysis | GO:0006096 | Biological Process | 0.0 | - |
| Sma3 | tricarboxylic acid cycle | GO:0006099 | Biological Process | 0.0 | - |
| Sma3 | malate metabolic process | GO:0006108 | Biological Process | 0.0 | - |
| Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Lactate/malate dehydrogenase, N-terminal | IPR001236 | - | 0.0 | - |
| Sma3 | Malate dehydrogenase, active site | IPR001252 | - | 0.0 | - |
| Sma3 | L-lactate/malate dehydrogenase | IPR001557 | - | 0.0 | - |
| Sma3 | Malate dehydrogenase, type 2 | IPR010945 | - | 0.0 | - |
| Sma3 | Malate dehydrogenase, NAD-dependent, cytosolic | IPR011274 | - | 0.0 | - |
| Sma3 | Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal | IPR015955 | - | 0.0 | - |
| Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PQ46
Fln msg: Distance to subject end: 75 aas, your sequence is shorter than subject: 61 - 332
Fln protein:
G
Protein Length:
62
Fln nts:
C
Fln Alignment:
HLKU4M004IKZRN___LVTAGGEKSQVRGAVADDAWLQGEFITTVQNRGGXXXXXXXXXXXXXXXXXXVDHMRD
C0PQ46________________VVTGAGEKA-VRQLVADDAWLDGEFITTVQQRGAAIIKARKLSSALSAASSACDHIRD

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta