UniGene Name: sp_v3.0_unigene156760
Length: 190 nt
![]() |
---|
>sp_v3.0_unigene156760
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Protein arginine methyltransferase n=1 Tax=Micromonas sp. RCC299 RepID=C1EDF3_MICSR | - | - | 3.0e-15 | 58% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 53% |
Sma3 | Arginine methyltransferease | - | - | 1.283e-09 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Transferases, Transferring one-carbon groups, Methyltransferases. | EC:2.1.1.- | - | 2.345e-06 | - |
Source | Gene names |
---|---|
Sma3 | At3g20020; CHLREDRAFT_205758; MAL21.12; MICPUN_108349; MICPUN_109100; OsI_032963; OsI_34113; OsJ_31971; PHATRDRAFT_17184; POPTRDRAFT_418476; POPTRDRAFT_828212; POPTRDRAFT_832445; PRMT1; PRMT6; PRMT6.2; PRMT901; PRMT905; PtrRMT902; RCOM_1048110; RCOM_14541 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | - |
Sma3 | protein methyltransferase activity | GO:0008276 | Molecular Function | 0.0 | - |
Sma3 | protein methylation | GO:0006479 | Biological Process | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ribosomal L11 methyltransferase, PrmA | IPR010456 | - | 0.0 | - |
Sma3 | Methyltransferase type 11 | IPR013216 | - | 0.0 | - |
Sma3 | Methyltransferase type 12 | IPR013217 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G20020.1 | ATPRMT6, PRMT6 protein arginine methyltransferase 6 chr3:6984055-6987945 REVERSE LENGTH=435 | 5.0e-20 | 61% |
RefSeq | Arabidopsis thaliana | NP_188637.2 | protein arginine N-methyltransferase 6 [Arabidopsis thaliana] | 7.0e-20 | 61% |
RefSeq | Populus trichocarpa | XP_002310910.1 | hypothetical protein POPTRDRAFT_832445 [Populus trichocarpa] | 5.0e-19 | 58% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NWP3
Fln msg: Distance to subject end: 238 aas, your sequence is shorter than subject: 63 - 384
Fln protein:
I
Protein Length:
64
Fln nts:
T
Fln Alignment:
HLKU4M004II6QC___ILSLFASQAGARVVYAVDTSDIINQAKQIVLDNGFNGKVVCLQGKMEDVELPEKVDIIISEWM
A9NWP3________________ILAIWCAQAGARKVYAVEATKMSEHARQLVIGNGVSHIVDVIEGSMEDVMLPEKVDVIISEWM
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain