SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene156684

Length: 419 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>sp_v3.0_unigene156684
AGAATGCCCTCGGCGCTGCCGTCGACATCGGACCTGTCTCCGTCGCCATCGAGGCTGACCAGGCTGGATTCCAGCTCTACAAGTCTGGTGTCTTCTCCGGCACCTGCGGCCAGACCCTCGACCACGGTGTCCTCACTGTCGGCTACGGAACTGACTCCGGCCAGGACTACTGGAAGGTCAAGAACTCCTGGGGTACCTCCTGGGGTGAGCAGGGCTACATCCGCATGATCCGCAACAAGGACGAGTGCGGAATTGCCAACGAGCCTTCCTACCCTCTGTCCGGCTGAAGAGACTTGCGGATGCTGAGCCAGTTCTAAATGAACCCTCAGTTCTGCCTCTGCCATTCGTGGCATTGTGTTATTTCTGTTTTCGGCCTTTATGGCCCTTTGGCTTTCAGTACATCTGAGTCTTGGTCTACC

Ace file of the UniGene sp_v3.0_unigene156684 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Cysteine protease 1 n=3 Tax=Brachiaria hybrid cultivar RepID=D0ES61_9POAL	-	-	4.0e-36	78%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	63%
Sma3	Cysteine proteinase	-	-	0.0	-

Source	ECs	Term	Type	e value	Identity
Sma3	2-alkenal reductase.	EC:1.3.1.74	-	1.467e-11	-
Sma3	Hydrolases, Acting on peptide bonds (peptide hydrolases), Cysteine endopeptidases.	EC:3.4.22.-	-	4.19605e-41	-

Source	Gene names
Sma3	AsNODf32; At1g06260; At1g09850; At1g47128; At3g19390; At3g19400; At3g19400/MLD14.12; At3g48350; At3g48350/T29H11_130; At4g11310; At4g11320; At4g35350; At4g36880; At5g43060; At5g43060/MMG4.7; At5g50260; B1417F08.21; BoCP3; BrCP3; C14; C7A10.480; CP1; CP2;

Source	GOs	Term	Type	Identity
Sma3	plant-type vacuole	GO:0000325	Cellular Component	-
Sma3	extracellular region	GO:0005576	Cellular Component	-
Sma3	cell wall	GO:0005618	Cellular Component	-
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	vacuole	GO:0005773	Cellular Component	-
Sma3	endoplasmic reticulum	GO:0005783	Cellular Component	-
Sma3	endoplasmic reticulum lumen	GO:0005788	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	cytoplasmic vesicle	GO:0031410	Cellular Component	-
Sma3	apoplast	GO:0048046	Cellular Component	-
Sma3	cysteine-type endopeptidase activity	GO:0004197	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	proteolysis	GO:0006508	Biological Process	-
Sma3	response to salt stress	GO:0009651	Biological Process	-
Sma3	developmental programmed cell death	GO:0010623	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Anaphylatoxin/fibulin	IPR000020	-	-
Sma3	Granulin	IPR000118	-	-
Sma3	Peptidase, cysteine peptidase active site	IPR000169	-	-
Sma3	Peptidase C1A, papain C-terminal	IPR000668	-	-
Sma3	Peptidase M14, carboxypeptidase A	IPR000834	-	-
Sma3	Ribosomal protein L5	IPR002132	-	-
Sma3	MD-2-related lipid-recognition	IPR003172	-	-
Sma3	EGF-like region, conserved site	IPR013032	-	-
Sma3	Phospholipase A2, active site	IPR013090	-	-
Sma3	Peptidase C1A, papain	IPR013128	-	-
Sma3	Proteinase inhibitor I29, cathepsin propeptide	IPR013201	-	-
Sma3	Aldehyde dehydrogenase, conserved site	IPR016160	-	-
Sma3		IPR018069	-	-
Sma3	Heat shock protein DnaJ, conserved site	IPR018253	-	-
Sma3	Ribosomal protein L29, conserved site	IPR018254	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT1G47128.1	RD21, RD21A Granulin repeat cysteine protease family protein chr1:17283139-17285609 REVERSE LENGTH=462	5.0e-34	60%
RefSeq	Arabidopsis thaliana	NP_564497.1	cysteine proteinase RD21a [Arabidopsis thaliana]	7.0e-34	60%
RefSeq	Populus trichocarpa	XP_002326950.1	predicted protein [Populus trichocarpa]	6.0e-34	64%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: A9NUC2

Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 68 aas, your sequence is shorter than subject: 95 - 463

Fln protein: NALGAAVDIGPVSVAIEADQAGFQLYKSGVFSGTCGQTLDHGVLTVGYGTDSGQDYWKVKNSWGTSWGEQGYIRMIRNKDECGIANEPSYPLSG*

Protein Length: 96

Fln nts: AGAATGCCCTCGGCGCTGCCGTCGACATCGGACCTGTCTCCGTCGCCATCGAGGCTGACCAGGCTGGATTCCAGCTCTACAAGTCTGGTGTCTTCTCCGGCACCTGCGGCCAGACCCTCGACCACGGTGTCCTCACTGTCGGCTACGGAACTGACTCCGGCCAGGACTACTGGAAGGTCAAGAACTCCTGGGGTACCTCCTGGGGTGAGCAGGGCTACATCCGCATGATCCGCAACAAGGACGAGTGCGGAATTGCCAACGAGCCTTCCTACCCTCTGTCCGGCTGAAGAGACTTGCGGATGCTGAGCCAGTTCTAAATGAACCCTCAGTTCTGCCTCTGCCATTCGTGGCATTGTGTTATTTCTGTTTTCGGCCTTTATGGCCCTTTGGCTTTCAGTACATCTGAGTCTTGGTCTACC

Fln Alignment:

HLKU4M004IZIIC___PVSVAIEADQAGFQLYKSGVFSGTCGQTLDHGVLTVGYGTDSGQDYWKVKNSWGTSWGEQGYIRMIRNKD-----ECGIANEPSYPL
A9NUC2________________PISVAIEASGRAFQFYESGVFTSTCGTQLDHGVTLVGYGSESGTDYWIVKNSWGKSWGEKGFIRLQRNIEGVSTGMCGIAMEASYPL

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain