|
||||||
|
UniGene Name: sp_v3.0_unigene156665
Length: 122 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene156665
C |
|
Ace file of the UniGene sp_v3.0_unigene156665
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | GTP-binding protein ypt5 [Aspergillus terreus NIH2624] gb|EAU34469.1| GTP-binding protein ypt5 [Aspergillus terreus NIH2624] | - | - | 5.0e-12 | 82% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 75% |
| Sma3 | Rab5/RabF-family small GTPase | - | - | 2.812e-11 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Sphingomyelin phosphodiesterase. | EC:3.1.4.12 | - | 3.439e-07 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Sphingolipid metabolism | 00600 | 3.439e-07 | % | |
| Sma3 | Metabolic pathways | 01100 | 3.439e-07 | % |
| Source | Gene names |
|---|---|
| Sma3 | ARA6; ARA7; AT3G54840; AT4g19640; At3g54840; At4g19640; At5g45130; CHLREDRAFT_81259; F24J7.190; F28P10.180; GSVIVT00016755001; GSVIVT00018151001; GSVIVT00023506001; GSVIVT00034414001; K17O22.15; LOC_Os03g05740; LOC_Os03g46390; LOC_Os10g30520; LOC_Os12g435 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | early endosome | GO:0005769 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | external side of endosome membrane | GO:0010009 | Cellular Component | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | GTP binding | GO:0005525 | Molecular Function | 0.0 | - |
| Sma3 | small GTPase mediated signal transduction | GO:0007264 | Biological Process | 0.0 | - |
| Sma3 | protein transport | GO:0015031 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Small GTPase superfamily | IPR001806 | - | 0.0 | - |
| Sma3 | RNA polymerase sigma factor 54, interaction | IPR002078 | - | 0.0 | - |
| Sma3 | Small GTPase superfamily, Rab type | IPR003579 | - | 0.0 | - |
| Sma3 | Small GTP-binding protein domain | IPR005225 | - | 0.0 | - |
| Sma3 | IPR013753 | - | 0.0 | - | |
| Sma3 | IPR015599 | - | 0.0 | - | |
| Sma3 | HTH domain AraC-type, conserved site | IPR018062 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G54840.1 | ARA6, ATRABF1, ARA-6, ATRAB5C Ras-related small GTP-binding family protein chr3:20318597-20320782 FORWARD LENGTH=202 | 2.0e-16 | 72% |
| RefSeq | Arabidopsis thaliana | NP_001078287.1 | Ras-related small GTP-binding family protein [Arabidopsis thaliana] | 2.0e-16 | 72% |
| RefSeq | Populus trichocarpa | XP_002311076.1 | predicted protein [Populus trichocarpa] | 4.0e-16 | 75% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NMT0
Fln msg: Distance to subject end: 99 aas, your sequence is shorter than subject: 40 - 202
Fln protein:
T
Protein Length:
41
Fln nts:
C
Fln Alignment:
HLKU4M004JSY3C___TIGAAFLTQTVALSDGTMVKFEIWDTAGQERFNSLAPMYY
A9NMT0________________TVGASFLSQTIALQDSTTVKFEIWDTAGQERYASLAPLYY
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
