|
||||||
|
UniGene Name: sp_v3.0_unigene156664
Length: 194 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene156664
A |
|
Ace file of the UniGene sp_v3.0_unigene156664 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Probable succinyl-CoA ligase [ADP-forming] subunit alpha, mitochondrial n=8 Tax=Poaceae RepID=SUCA_ORYSJ | - | - | 3.0e-19 | 72% |
| FL-Next | sp=Probable succinyl-CoA ligase [ADP-forming] subunit alpha, mitochondrial; Oryza sativa subsp. japonica (Rice). | - | - | 0.0 | 72% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Succinate--CoA ligase (GDP-forming). | EC:6.2.1.4 | - | 4.275e-20 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Citrate cycle (TCA cycle) | 00020 | 4.275e-20 | % | |
| Sma3 | Propanoate metabolism | 00640 | 4.275e-20 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 4.275e-20 | % | |
| Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 4.275e-20 | % | |
| Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 4.275e-20 | % | |
| Sma3 | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 4.275e-20 | % | |
| Sma3 | Biosynthesis of alkaloids derived from histidine and purine | 01065 | 4.275e-20 | % | |
| Sma3 | Biosynthesis of alkaloids derived from terpenoid and polyketide | 01066 | 4.275e-20 | % | |
| Sma3 | Biosynthesis of plant hormones | 01070 | 4.275e-20 | % | |
| Sma3 | Metabolic pathways | 01100 | 4.275e-20 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 4.275e-20 | % |
| Source | Gene names |
|---|---|
| Sma3 | At5g08300; At5g23250; CHLREDRAFT_196570; F8L15_30; GSVIVT00031891001; GSVIVT00037069001; MICPUCDRAFT_45127; MICPUN_54789; MKD15.11; OSTLU_30915; Os07g0577700; OsI_26601; OsJ_24862; Ot03g05850; PHATRDRAFT_42015; PHYPADRAFT_148732; PHYPADRAFT_209911; PHYPAD |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | ATP citrate synthase activity | GO:0003878 | Molecular Function | 0.0 | - |
| Sma3 | succinate-CoA ligase (ADP-forming) activity | GO:0004775 | Molecular Function | 0.0 | - |
| Sma3 | succinate-CoA ligase (GDP-forming) activity | GO:0004776 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | GTP binding | GO:0005525 | Molecular Function | 0.0 | - |
| Sma3 | metal ion binding | GO:0046872 | Molecular Function | 0.0 | - |
| Sma3 | tricarboxylic acid cycle | GO:0006099 | Biological Process | 0.0 | - |
| Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Chlorophyll A-B binding protein, plant | IPR001344 | - | 0.0 | - |
| Sma3 | CoA-binding | IPR003781 | - | 0.0 | - |
| Sma3 | Succinyl-CoA ligase, alpha subunit | IPR005810 | - | 0.0 | - |
| Sma3 | ATP-citrate lyase/succinyl-CoA ligase | IPR005811 | - | 0.0 | - |
| Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
| Sma3 | Succinyl-CoA synthetase-like | IPR016102 | - | 0.0 | - |
| Sma3 | ATP-citrate lyase/succinyl-CoA ligase, active site | IPR017440 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G08300.1 | Succinyl-CoA ligase, alpha subunit chr5:2667579-2669672 FORWARD LENGTH=347 | 1.0e-24 | 70% |
| RefSeq | Arabidopsis thaliana | NP_196447.1 | Succinyl-CoA ligase [GDP-forming] subunit alpha-1 [Arabidopsis thaliana] | 2.0e-24 | 70% |
| RefSeq | Populus trichocarpa | XP_002307162.1 | predicted protein [Populus trichocarpa] | 7.0e-25 | 73% |
| Full-Lengther Next Prediction |
|---|
Fln status: C-terminus
Fln database: sp_plants
Fln subject: Q6ZL94
Fln msg: your sequence is shorter than subject: 62 - 331
Fln protein:
I
Protein Length:
63
Fln nts:
A
Fln Alignment:
HLKU4M004H5S7T___IAGVTAPPGRRMGHAGAIISGGKGDAPSKINALKDAGVTVSESPARLGTTMYQVFKDRGLL
Q6ZL94________________IAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKALREAGVTVVESPAKIGSTMFEIFKQRGML
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
