SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene156647

Length: 173 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>sp_v3.0_unigene156647
GGTTGCAAGCTCATTGATGATATCTACGCCCAACACCAAGACCTCAAGGTTACTGACAGAAGTTTGATCTGGAACACTGATTTGATTGAAGCCCTTGAACTCCAGAACTTGATGACACAAGCTGTGCTAACTATGTACTCTGCTGAAGCCAGAACTGAATCAAGAGGAGCTCA

Ace file of the UniGene sp_v3.0_unigene156647 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Succinate dehydrogenase flavoprotein alpha subunit (ISS) n=2 Tax=Ostreococcus RepID=Q00WK0_OSTTA	-	-	9.0e-15	70%
FL-Next	sp=Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial; Oryza sativa subsp. japonica (Rice).	-	-	0.0	61%
Sma3	FP	-	-	1.502e-12	-

Source	ECs	Term	Type	e value	Identity
Sma3	Succinate dehydrogenase (ubiquinone).	EC:1.3.5.1	-	6.478e-16	-

Source	KEGGs	Term	e value	Identity
Sma3	Citrate cycle (TCA cycle)	00020	6.478e-16	%
Sma3	Oxidative phosphorylation	00190	6.478e-16	%
Sma3	Biosynthesis of phenylpropanoids	01061	6.478e-16	%
Sma3	Biosynthesis of terpenoids and steroids	01062	6.478e-16	%
Sma3	Biosynthesis of alkaloids derived from shikimate pathway	01063	6.478e-16	%
Sma3	Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid	01064	6.478e-16	%
Sma3	Biosynthesis of alkaloids derived from histidine and purine	01065	6.478e-16	%
Sma3	Biosynthesis of alkaloids derived from terpenoid and polyketide	01066	6.478e-16	%
Sma3	Biosynthesis of plant hormones	01070	6.478e-16	%
Sma3	Metabolic pathways	01100	6.478e-16	%
Sma3	Biosynthesis of secondary metabolites	01110	6.478e-16	%

Source	Gene names
Sma3	At2g18450; At5g66760; CHLREDRAFT_195972; GSVIVT00024946001; LOC_Os07g04240; MICPUCDRAFT_30055; MICPUN_106467; MSN2.16; OSTLU_29304; Os07g0134800; OsI_24801; OsJ_23002; Ot14g00120; P0507H12.27; PHYPADRAFT_181904; PHYPADRAFT_196863; POPTRDRAFT_219180; POPTR

Source	GOs	Term	Type	Identity
Sma3	cell wall	GO:0005618	Cellular Component	-
Sma3	mitochondrial inner membrane	GO:0005743	Cellular Component	-
Sma3	succinate dehydrogenase activity	GO:0000104	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	succinate dehydrogenase (ubiquinone) activity	GO:0008177	Molecular Function	-
Sma3	electron carrier activity	GO:0009055	Molecular Function	-
Sma3	oxidoreductase activity, acting on the CH-CH group of donors	GO:0016627	Molecular Function	-
Sma3	flavin adenine dinucleotide binding	GO:0050660	Molecular Function	-
Sma3	tricarboxylic acid cycle	GO:0006099	Biological Process	-
Sma3	mitochondrial electron transport, succinate to ubiquinone	GO:0006121	Biological Process	-
Sma3	transport	GO:0006810	Biological Process	-
Sma3	electron transport chain	GO:0022900	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Fumarate reductase/succinate dehydrogenase, FAD-binding site	IPR003952	-	-
Sma3	Fumarate reductase/succinate dehydrogenase flavoprotein, N-terminal	IPR003953	-	-
Sma3		IPR004112	-	-
Sma3	Succinate dehydrogenase, flavoprotein subunit	IPR011281	-	-
Sma3	FAD-dependent pyridine nucleotide-disulphide oxidoreductase	IPR013027	-	-
Sma3	Succinate dehydrogenase/fumarate reductase, flavoprotein subunit	IPR014006	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT2G18450.1	SDH1-2 succinate dehydrogenase 1-2 chr2:7997510-8000801 REVERSE LENGTH=632	5.0e-18	63%
RefSeq	Arabidopsis thaliana	NP_179435.1	succinate dehydrogenase [ubiquinone] flavoprotein subunit 2 [Arabidopsis thaliana]	6.0e-18	63%
RefSeq	Populus trichocarpa	XP_002327807.1	predicted protein [Populus trichocarpa]	8.0e-18	64%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: sp_plants

Fln subject: Q6ZDY8

Fln msg: Distance to subject end: 52 aas, your sequence is shorter than subject: 57 - 630

Fln protein: GCKLIDDIYAQHQDLKVTDRSLIWNTDLIEALELQNLMTQAVLTMYSAEARTESRGA

Protein Length: 58

Fln nts: GGTTGCAAGCTCATTGATGATATCTACGCCCAACACCAAGACCTCAAGGTTACTGACAGAAGTTTGATCTGGAACACTGATTTGATTGAAGCCCTTGAACTCCAGAACTTGATGACACAAGCTGTGCTAACTATGTACTCTGCTGAAGCCAGAACTGAATCAAGAGGAGCTCA

Fln Alignment:

HLKU4M004JAW32___GCKLIDDIYAQHQDLKVTDRSLIWNTDLIEALELQNLMTQAVLTMYSAEARTESRGA
Q6ZDY8________________GCKLITKAWESYHDVKISDRSLIWNSDLIETIELENLLINACITMHSAEARKESRGA

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain