UniGene Name: sp_v3.0_unigene156633
Length: 238 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene156633
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | cathepsin L [Hymeniacidon perlevis] | - | - | 3.0e-28 | 78% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 50% |
Sma3 | Cysteine protease | - | - | 2.542e-29 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Hydrolases, Acting on peptide bonds (peptide hydrolases), Cysteine endopeptidases. | EC:3.4.22.- | - | 2.987e-15 | - |
Sma3 | Cathepsin H. | EC:3.4.22.16 | - | 1.261e-08 | - |
Source | Gene names |
---|---|
Sma3 | AALP; ALEU; AT1G47128; AT5G60360; AsNODf32; At1g06260; At1g09850; At1g20850; At3g19390; At3g19400; At3g19400/MLD14.12; At4g35350; At5g43060; At5g43060/MMG4.7; At5g60360; B1417F08.21; BoCP3; BrCP3; CCP2; CP1; CP2; CP3; CP5; CPRS1; CPRZ; CYP-3; CYS; CYS1; D |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plant-type vacuole | GO:0000325 | Cellular Component | 0.0 | - |
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
Sma3 | cysteine-type endopeptidase activity | GO:0004197 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | aging | GO:0007568 | Biological Process | 0.0 | - |
Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
Sma3 | developmental programmed cell death | GO:0010623 | Biological Process | 0.0 | - |
Sma3 | GO:0045449 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Anaphylatoxin/fibulin | IPR000020 | - | 0.0 | - |
Sma3 | Granulin | IPR000118 | - | 0.0 | - |
Sma3 | Peptidase, cysteine peptidase active site | IPR000169 | - | 0.0 | - |
Sma3 | Peptidase C1A, papain C-terminal | IPR000668 | - | 0.0 | - |
Sma3 | Peptidase M14, carboxypeptidase A | IPR000834 | - | 0.0 | - |
Sma3 | Mannose-binding lectin | IPR001229 | - | 0.0 | - |
Sma3 | EGF-like region, conserved site | IPR013032 | - | 0.0 | - |
Sma3 | Phospholipase A2, active site | IPR013090 | - | 0.0 | - |
Sma3 | Peptidase C1A, papain | IPR013128 | - | 0.0 | - |
Sma3 | Proteinase inhibitor I29, cathepsin propeptide | IPR013201 | - | 0.0 | - |
Sma3 | Aldehyde dehydrogenase, conserved site | IPR016160 | - | 0.0 | - |
Sma3 | IPR018069 | - | 0.0 | - | |
Sma3 | Heat shock protein DnaJ, conserved site | IPR018253 | - | 0.0 | - |
Sma3 | Ribosomal protein L29, conserved site | IPR018254 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G19390.1 | Granulin repeat cysteine protease family protein chr3:6723024-6724768 FORWARD LENGTH=452 | 2.0e-21 | 54% |
RefSeq | Arabidopsis thaliana | NP_566633.1 | Granulin repeat cysteine protease family protein [Arabidopsis thaliana] | 3.0e-21 | 54% |
RefSeq | Populus trichocarpa | XP_002338508.1 | predicted protein [Populus trichocarpa] | 6.0e-22 | 57% |
![]() |
---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: A9P285
Fln msg: STOP codon was not found. Distance to subject end: 0 aas, your sequence is shorter than subject: 79 - 367
Fln protein:
Y
Protein Length:
80
Fln nts:
T
Fln Alignment:
HLKU4M004H22WE___YSGGVYYSAGCS--PTSLDHGVLAVGYGVYQGSDYWLVKNSWGTSWGLQGYIMMSRNRN---NNCGIATMASYPTGAKAA
A9P285________________YTGGIY-DGDCSGNPDDIDHAVLVVGYSAKNGKDYWIVKNSWGTDWGLEGYFYILRNTELPYGVCAINAMASYPTKTESS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain