UniGene Name: sp_v3.0_unigene156606
Length: 242 nt
![]() |
---|
>sp_v3.0_unigene156606
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Ubiquitin carrier protein n=1 Tax=Ustilago maydis 521 RepID=Q4P877_USTMA | - | - | 2.0e-19 | 70% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 67% |
Sma3 | Ubiquitin carrier protein | - | - | 1.709e-13 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ligases, Forming carbon-nitrogen bonds, Acid--D-amino-acid ligases (peptide synthases). | EC:6.3.2.- | - | 1.01e-12 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Tryptophan metabolism | 00380 | 1.01e-12 | % | |
Sma3 | Biosynthesis of siderophore group nonribosomal peptides | 01053 | 1.01e-12 | % |
Source | Gene names |
---|---|
Sma3 | At1g16890; At1g78870; CHLREDRAFT_129070; F17F16.19; F6I1.11; F9K20.8; GSVIVT00018730001; GSVIVT00027804001; MICPUCDRAFT_46797; MICPUN_106902; Os01g0673600; OsI_03230; OsJ_02975; P0007F06.32; P0485G01.22; PHATRDRAFT_36198; PHYPADRAFT_106208; PHYPADRAFT_170 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | UBC13-MMS2 complex | GO:0031372 | Cellular Component | 0.0 | - |
Sma3 | ubiquitin-protein ligase activity | GO:0004842 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | small conjugating protein ligase activity | GO:0019787 | Molecular Function | 0.0 | - |
Sma3 | modification-dependent protein catabolic process | GO:0019941 | Biological Process | 0.0 | - |
Sma3 | post-translational protein modification | GO:0043687 | Biological Process | 0.0 | - |
Sma3 | regulation of protein metabolic process | GO:0051246 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ubiquitin-conjugating enzyme, E2 | IPR000608 | - | 0.0 | - |
Sma3 | Haloacid dehalogenase-like hydrolase | IPR005834 | - | 0.0 | - |
Sma3 | HAD-superfamily hydrolase, subfamily IA, variant 3 | IPR006402 | - | 0.0 | - |
Sma3 | Ubiquitin-conjugating enzyme/RWD-like | IPR016135 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G78870.1 | UBC35, UBC13A ubiquitin-conjugating enzyme 35 chr1:29650589-29652203 FORWARD LENGTH=154 | 2.0e-22 | 66% |
RefSeq | Arabidopsis thaliana | NP_001031298.1 | ubiquitin-conjugating enzyme E2 35 [Arabidopsis thaliana] | 1.0e-24 | 67% |
RefSeq | Populus trichocarpa | XP_002316867.1 | predicted protein [Populus trichocarpa] | 2.0e-24 | 64% |
![]() |
---|
Fln status: N-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NNB1
Fln msg: Distance to subject end: 90 aas, your sequence is shorter than subject: 60 - 153
Fln protein:
M
Protein Length:
61
Fln nts:
A
Fln Alignment:
HLKU4M004J02KK___STMSLPTRVLKEIQRLVNDPVPGISASPHQDNLRYFDVIIAGPSSSPYEGGTFKLELFLTEE
A9NNB1________________SNSNLPRRIIKETQRLLSEPAPGISASPSEENLRYFNVMILGPSQSPYEGGVFKLELFLPEE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain