UniGene Name: sp_v3.0_unigene156207
Length: 248 nt
UniGene Fasta |
---|
>sp_v3.0_unigene156207
A |
Ace file of the UniGene sp_v3.0_unigene156207 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Inorganic pyrophosphatase n=1 Tax=Dictyostelium fasciculatum RepID=F4PT49_9MYCE | - | - | 4.0e-27 | 69% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 56% |
Sma3 | Soluble inorganic pyrophosphatase 1, chloroplastic | - | - | 3.681e-09 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Inorganic diphosphatase. | EC:3.6.1.1 | - | 3.24e-08 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Oxidative phosphorylation | 00190 | 3.24e-08 | % |
Source | Gene names |
---|---|
Sma3 | At5g09650; CHLREDRAFT_133620; F17I14_160; GSVIVT00013522001; GSVIVT00015038001; IPY1; OJ1767_D02.15-1; OJ1767_D02.15-2; Os02g0768600; OsI_09082; OsJ_08520; PHYPADRAFT_154128; POPTRDRAFT_557583; POPTRDRAFT_707493; PPA; PPA1; RCOM_0816840; THAPSDRAFT_5188; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
Sma3 | thylakoid | GO:0009579 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
Sma3 | inorganic diphosphatase activity | GO:0004427 | Molecular Function | 0.0 | - |
Sma3 | phosphate-containing compound metabolic process | GO:0006796 | Biological Process | 0.0 | - |
Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
Sma3 | defense response to bacterium | GO:0042742 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Adenosine/AMP deaminase active site | IPR006650 | - | 0.0 | - |
Sma3 | Inorganic pyrophosphatase | IPR008162 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G09650.1 | AtPPa6, PPa6 pyrophosphorylase 6 chr5:2991331-2993117 REVERSE LENGTH=300 | 2.0e-21 | 56% |
RefSeq | Arabidopsis thaliana | NP_196527.1 | soluble inorganic pyrophosphatase 1 [Arabidopsis thaliana] | 3.0e-21 | 56% |
RefSeq | Populus trichocarpa | XP_002313207.1 | predicted protein [Populus trichocarpa] | 2.0e-21 | 56% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NLE1
Fln msg: Distance to subject end: 56 aas, your sequence is shorter than subject: 82 - 303
Fln protein:
H
Protein Length:
83
Fln nts:
A
Fln Alignment:
HLKU4M004IMPM4___AKGDNDPLDACEIGSVTAVRGQIRQVKVLGTWAMIDEGETDWKILCIDVNDPKASLLNSLEDVETHFPGVI
A9NLE1________________AFGDNDPVDVVEIGERQAKMGEVLKVKPLAALAMIDEGELDWKIVAISVDDPRAPLVNDVNDVEKHFPGTL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain