SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene156061

Length: 234 nt

UniGene Fasta

>sp_v3.0_unigene156061
AGCATGAATGATTTACCAGATTCTATCAAGTCTATCGTAAAAGGTGGTGGTTCATTAACTGCATTACCAATTATCGAAACTCAAGCTGGTGACGTTTCTGCATATATCCCAACAAACGTAATTTCGATTACAGATGGTCAGATTTTCCTTGATGGAGATTTGTTCAACTCTGGAGTTCGTCCTGCAATTAACGTTGGTATCTCTGTATCTCGTGTTGGAGGTAATGCTCAGATT

Ace file of the UniGene sp_v3.0_unigene156061

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	ATP synthase subunit alpha n=2 Tax=Polaribacter RepID=A2TYK2_9FLAO	-	-	8.0e-35	97%
FL-Next	sp=ATP synthase subunit alpha, chloroplastic; Agathis australis (Kauri) (Dammara australis). Plastid; Chloroplast.	-	-	0.0	87%
Sma3	F-ATPase subunit alpha	-	-	0.0	-

Source	ECs	Term	Type	e value	Identity
Sma3	H(+)-transporting two-sector ATPase.	EC:3.6.3.14	-	1.331e-32	-

Source	KEGGs	Term	e value	Identity
Sma3	Oxidative phosphorylation	00190	1.331e-32	%
Sma3	Photosynthesis	00195	1.331e-32	%
Sma3	Methane metabolism	00680	1.331e-32	%
Sma3	Metabolic pathways	01100	1.331e-32	%

Source	Gene names
Sma3	Atp1; CLPGMS-2208; GSVIVT00035586001; Grc000146; HAM_013; Heak293_Cp081; JNC0116; LOC_Os10g21240; LOC_Os10g38270; LopeCp030; OSJNAb0075K12.16; OSJNBa0061C08.5; OSJNBb0005J14.21; OSJNBb0075K12.32; OsI_15081; OtCpg00470; OtMtg00170; PHATRDRAFT_47835; POPTRD

Source	GOs	Term	Type	Identity
Sma3	mitochondrion	GO:0005739	Cellular Component	-
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	plastid	GO:0009536	Cellular Component	-
Sma3	thylakoid	GO:0009579	Cellular Component	-
Sma3	cyanelle	GO:0009842	Cellular Component	-
Sma3	plastid membrane	GO:0042170	Cellular Component	-
Sma3	proton-transporting ATP synthase complex, catalytic core F(1)	GO:0045261	Cellular Component	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	hydrogen ion transporting ATP synthase activity, rotational mechanism	GO:0046933	Molecular Function	-
Sma3	proton-transporting ATPase activity, rotational mechanism	GO:0046961	Molecular Function	-
Sma3	ATP synthesis coupled proton transport	GO:0015986	Biological Process	-
Sma3	plasma membrane ATP synthesis coupled proton transport	GO:0042777	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	ATPase, F1 complex, gamma subunit	IPR000131	-	-
Sma3	ATPase, F1/V1/A1 complex, alpha/beta subunit, nucleotide-binding domain	IPR000194	-	-
Sma3	ATPase, F1/V1/A1 complex, alpha/beta subunit, C-terminal	IPR000793	-	-
Sma3	ATPase, F1 complex, delta/epsilon subunit	IPR001469	-	-
Sma3	ATPase, F1/V1/A1 complex, alpha/beta subunit, N-terminal	IPR004100	-	-
Sma3	ATPase, F1 complex, alpha subunit	IPR005294	-	-
Sma3	DNA ligase, ATP-dependent, C-terminal	IPR012309	-	-
Sma3	DNA ligase, ATP-dependent, central	IPR012310	-	-
Sma3	Nucleic acid-binding, OB-fold	IPR012340	-	-
Sma3	DNA ligase, ATP-dependent, conserved site	IPR016059	-	-
Sma3		IPR017458	-	-
Sma3	Hemopexin/matrixin, conserved site	IPR018486	-	-
Sma3	HerA-ATP synthase, barrel domain	IPR018538	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	ATCG00120.1	ATPA ATP synthase subunit alpha chrC:9938-11461 REVERSE LENGTH=507	1.0e-29	84%
RefSeq	Arabidopsis thaliana	NP_085571.2	ATPase subunit 1 (mitochondrion) [Arabidopsis thaliana]	7.0e-27	79%
RefSeq	Populus trichocarpa	XP_002332596.1	predicted protein, partial [Populus trichocarpa]	2.0e-30	84%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: G8HSM7

Fln msg: Distance to subject end: 134 aas, your sequence is shorter than subject: 78 - 507

Fln protein: SMNDLPDSIKSIVKGGGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLDGDLFNSGVRPAINVGISVSRVGGNAQI

Protein Length: 79

Fln nts: AGCATGAATGATTTACCAGATTCTATCAAGTCTATCGTAAAAGGTGGTGGTTCATTAACTGCATTACCAATTATCGAAACTCAAGCTGGTGACGTTTCTGCATATATCCCAACAAACGTAATTTCGATTACAGATGGTCAGATTTTCCTTGATGGAGATTTGTTCAACTCTGGAGTTCGTCCTGCAATTAACGTTGGTATCTCTGTATCTCGTGTTGGAGGTAATGCTCAGATT

Fln Alignment:

HLKU4M004I124J___GGGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLDGDLFNSGVRPAINVGISVSRVGGNAQI
G8HSM7________________GGGSLTALPIVETQAGDVSAYIPTNVISITDGQIFLSADLFNAGMKPAINVGISVSRVGSAAQI

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain