|
||||||
|
UniGene Name: sp_v3.0_unigene155657
Length: 180 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene155657
C |
|
Ace file of the UniGene sp_v3.0_unigene155657
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Vacuolar-type H(+)-ATPase subunit c n=1 Tax=Syntrichia ruralis RepID=Q947K5_TORRU | - | - | 9.0e-10 | 85% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 85% |
| Sma3 | Vacuolar ATP synthase | - | - | 1.78e-07 | - |
| Source | Gene names |
|---|---|
| Sma3 | ATPvL1; AVA-P1; AVA-P2; AVA-P3; AVA-P4; AVA-P5; AVAP1; AVAP2; AVAP3; AVAP4; AVAP5; At1g19910; At1g75630; At2g16510; At4g34720; At4g38920; BV-16/1; BVA-16/2; CHLREDRAFT_134189; CVA16-2; CVA16-4; Cit-VATP c-1; Cit-VATP c-2; Cit-VATP c-3; CitVATP c-1; CitVAT |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | vacuolar membrane | GO:0005774 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | proton-transporting V-type ATPase, V0 domain | GO:0033179 | Cellular Component | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | hydrogen ion transmembrane transporter activity | GO:0015078 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | ATP synthesis coupled proton transport | GO:0015986 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | C2 calcium-dependent membrane targeting | IPR000008 | - | 0.0 | - |
| Sma3 | ATPase, V0 complex, proteolipid subunit C | IPR000245 | - | 0.0 | - |
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
| Sma3 | ATPase, F0/V0 complex, subunit C | IPR002379 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | Copine | IPR010734 | - | 0.0 | - |
| Sma3 | ATPase, V0 complex, proteolipid subunit C, eukaryotic | IPR011555 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat-containing N-terminal, type 2 | IPR013210 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - | |
| Sma3 | C2 membrane targeting protein | IPR018029 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G34720.1 | AVA-P1, VHA-C1, ATVHA-C1 ATPase, F0/V0 complex, subunit C protein chr4:16568223-16569165 REVERSE LENGTH=164 | 4.0e-15 | 85% |
| RefSeq | Arabidopsis thaliana | NP_195603.1 | V-type H+-transporting ATPase 16kDa proteolipid subunit [Arabidopsis thaliana] | 5.0e-15 | 85% |
| RefSeq | Populus trichocarpa | XP_002306142.1 | predicted protein [Populus trichocarpa] | 5.0e-15 | 85% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NL02
Fln msg: Distance to subject end: 80 aas, your sequence is shorter than subject: 59 - 165
Fln protein:
C
Protein Length:
60
Fln nts:
C
Fln Alignment:
HLKU4M004JPJ2C___CLGAAYGTAKSGVGVASMGVIRPDLVMRSIIPVVM
A9NL02________________CMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
