UniGene Name: sp_v3.0_unigene155384
Length: 247 nt
UniGene Fasta |
---|
>sp_v3.0_unigene155384
T |
Ace file of the UniGene sp_v3.0_unigene155384 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | DNA-directed RNA polymerase, beta subunit family protein [Tetrahymena thermophila] gb|EAR82894.1| DNA-directed RNA polymerase, beta subunit family protein [Tetrahymena thermophila SB210] | - | - | 1.0e-24 | 64% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 46% |
Sma3 | DNA-directed RNA polymerase | - | - | 7.765e-15 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | DNA-directed RNA polymerase. | EC:2.7.7.6 | - | 9.005e-14 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Purine metabolism | 00230 | 9.005e-14 | % | |
Sma3 | Pyrimidine metabolism | 00240 | 9.005e-14 | % | |
Sma3 | Metabolic pathways | 01100 | 9.005e-14 | % |
Source | Gene names |
---|---|
Sma3 | ACR2; Acr2; At1g29940; CHLREDRAFT_113199; F1N18.2; GSVIVT00030883001; LOC_Os10g35290; MICPUCDRAFT_55696; MICPUN_107316; OSJNBa0041P03.1; OSTLU_119522; Os10g0495600; OsI_34174; OsJ_32024; PHATRDRAFT_9235; PHYPADRAFT_191908; POPTRDRAFT_178400; RCOM_1264750; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | DNA-directed RNA polymerase activity | GO:0003899 | Molecular Function | 0.0 | - |
Sma3 | ribonucleoside binding | GO:0032549 | Molecular Function | 0.0 | - |
Sma3 | GO:0006350 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | DNA-directed RNA polymerase, subunit 2, domain 6 | IPR007120 | - | 0.0 | - |
Sma3 | RNA polymerase, beta subunit, conserved site | IPR007121 | - | 0.0 | - |
Sma3 | RNA polymerase Rpb2, domain 7 | IPR007641 | - | 0.0 | - |
Sma3 | RNA polymerase Rpb2, domain 2 | IPR007642 | - | 0.0 | - |
Sma3 | RNA polymerase, beta subunit, protrusion | IPR007644 | - | 0.0 | - |
Sma3 | RNA polymerase Rpb2, domain 3 | IPR007645 | - | 0.0 | - |
Sma3 | RNA polymerase Rpb2, domain 5 | IPR007647 | - | 0.0 | - |
Sma3 | RNA polymerase I, Rpa2 specific | IPR009674 | - | 0.0 | - |
Sma3 | DNA-directed RNA polymerase, subunit 2 | IPR015712 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G29940.1 | NRPA2 nuclear RNA polymerase A2 chr1:10479322-10486670 REVERSE LENGTH=1178 | 4.0e-24 | 62% |
RefSeq | Arabidopsis thaliana | NP_564341.2 | nuclear RNA polymerase A2 [Arabidopsis thaliana] | 5.0e-24 | 62% |
RefSeq | Populus trichocarpa | XP_002297732.1 | predicted protein, partial [Populus trichocarpa] | 8.0e-28 | 66% |
Full-Lengther Next Prediction |
---|
Fln status: Putative N-terminus
Fln database: coniferopsida.fasta
Fln subject: D5ABJ4
Fln msg: Distance to subject end: 51 aas, atg_distance in limit (1-15): atg_distance = 3, W2: There is no M at the beginning, your sequence is shorter than subject: 81 - 135
Fln protein:
S
Protein Length:
82
Fln nts:
T
Fln Alignment:
HLKU4M004IWLH9___DKSQVRSTGPVTAVTRQPVKGRKKHGGIRLGEMERDALLSHGVAFCLHDRLMNCSDSHTAFVCKQCGGILSVYAKISS
D5ABJ4________________DKIHSRGRGPVQILTRQPAEGRSRDGGLRFGEMERDCMIAHGAAHFLKERLFDQSDAYRVHVCERCGLIAIANLKKNS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain